DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sdk and KIRREL1

DIOPT Version :9

Sequence 1:NP_001284756.1 Gene:sdk / 31017 FlyBaseID:FBgn0021764 Length:2265 Species:Drosophila melanogaster
Sequence 2:XP_005245362.1 Gene:KIRREL1 / 55243 HGNCID:15734 Length:773 Species:Homo sapiens


Alignment Length:485 Identity:116/485 - (23%)
Similarity:178/485 - (36%) Gaps:134/485 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 PQDVKVKVGTGVVELQCI-ANARPLHELETLWLKDGLAVETAGVRHTLNDPWNR----------- 319
            |.|..|..|...| |.|: .|...:.:    |.|||||:   |:...|. .|.|           
Human    27 PADQTVVAGQRAV-LPCVLLNYSGIVQ----WTKDGLAL---GMGQGLK-AWPRYRVVGSADAGQ 82

  Fly   320 -TLALLQANSSHSGEYTCQ---VRLRSGGYPAVSASARLQILEPPLFFTPMRAETFGEFGGQV-- 378
             .|.:..|..|....|.||   ..||       |..|:|.:|.||        |.....||.|  
Human    83 YNLEITDAELSDDASYECQATEAALR-------SRRAKLTVLIPP--------EDTRIDGGPVIL 132

  Fly   379 -------QLTCDVV-GEPTPQVKWFRNAESVDAHIESGRYTLN-----TDNTLVIKKLILDDAAM 430
                   .|||... .:|...:.|||:....:..:.|.....:     |.:.|:|....||...:
Human   133 LQAGTPHNLTCRAFNAKPAATIIWFRDGTQQEGAVASTELLKDGKRETTVSQLLINPTDLDIGRV 197

  Fly   431 FQCLAINEA---GENSA---------STWLRVKTKTAK--NRV----KRLAQPRILRVRASHAGL 477
            |.|.::|||   |:.::         :..|.::.:|.:  .||    :..|.|.||..|.:..|.
Human   198 FTCRSMNEAIPSGKETSIELDVHHPPTVTLSIEPQTVQEGERVVFTCQATANPEILGYRWAKGGF 262

  Fly   478 GSEKGSES-----------------------GSSDRRKEFRFASAPIMELPPQNVTALDGKDATI 519
            ..|...||                       ||::.........||.:.:.|:..|...|.|.|:
Human   263 LIEDAHESRYETNVDYSFFTEPVSCEVHNKVGSTNVSTLVNVHFAPRIVVDPKPTTTDIGSDVTL 327

  Fly   520 SCRAVGSPNPNITWIYNETQL----------VDISSRVQILESGDLLISNIRSVDAGLYICVRA- 573
            :|..||:|...:||...::.:          ..:|::| :..|..||:.::...|||.|.| || 
Human   328 TCVWVGNPPLTLTWTKKDSNMGPRPPGSPPEAALSAQV-LSNSNQLLLKSVTQADAGTYTC-RAI 390

  Fly   574 -NEAGSVKGEAYLSV----LVRTQIIQPPVDTTVLLGLTATLQCKVSSDPSVPYNIDW-YREGQS 632
             ...|..:.|..|.|    ::.::.:|..|     .|....::|.:.|.|. |..|.| ::|   
Human   391 VPRIGVAEREVPLYVNGPPIISSEAVQYAV-----RGDGGKVECFIGSTPP-PDRIAWAWKE--- 446

  Fly   633 STPISNSQRIGVQADGQLEIQAVRASDVGS 662
                 |...:|.     ||...|..::.||
Human   447 -----NFLEVGT-----LERYTVERTNSGS 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sdkNP_001284756.1 Ig 71..157 CDD:299845
I-set 72..150 CDD:254352
Ig 172..245 CDD:299845
IG_like 280..356 CDD:214653 24/91 (26%)
Ig 280..343 CDD:299845 21/78 (27%)
IG_like 375..450 CDD:214653 23/101 (23%)
Ig 378..447 CDD:143165 20/95 (21%)
Ig 506..587 CDD:299845 26/92 (28%)
IG_like 506..587 CDD:214653 26/92 (28%)
I-set 592..682 CDD:254352 17/72 (24%)
Ig 595..682 CDD:299845 17/69 (25%)
FN3 686..789 CDD:238020
FN3 798..893 CDD:238020
FN3 901..1005 CDD:238020
fn3 1011..1094 CDD:278470
FN3 1108..1202 CDD:238020
FN3 1210..1308 CDD:238020
fn3 1317..1402 CDD:278470
FN3 1415..1507 CDD:238020
FN3 1513..1608 CDD:238020
fn3 1617..1708 CDD:278470
FN3 1722..1823 CDD:238020
FN3 1828..1920 CDD:238020
FN3 1927..2016 CDD:238020
KIRREL1XP_005245362.1 I-set 22..116 CDD:254352 29/104 (28%)
Ig 25..116 CDD:299845 29/104 (28%)
Ig2_KIRREL3-like 138..219 CDD:143236 19/80 (24%)
I-set 223..304 CDD:254352 15/80 (19%)
Ig_2 227..305 CDD:290606 15/77 (19%)
Ig_2 311..405 CDD:290606 26/95 (27%)
IG_like 314..405 CDD:214653 26/92 (28%)
Ig5_KIRREL3 407..504 CDD:143306 17/79 (22%)
IG_like 416..504 CDD:214653 17/70 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.