DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sdk and ROBO4

DIOPT Version :10

Sequence 1:NP_001284756.1 Gene:sdk / 31017 FlyBaseID:FBgn0021764 Length:2265 Species:Drosophila melanogaster
Sequence 2:NP_061928.4 Gene:ROBO4 / 54538 HGNCID:17985 Length:1007 Species:Homo sapiens


Alignment Length:535 Identity:126/535 - (23%)
Similarity:189/535 - (35%) Gaps:154/535 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   498 SAPIMELPPQNVTALDGKDATISCRAVGSPNPNITWIYNETQLVDISSRV-----QILESGDLLI 557
            |.|.:.:.||:........|.:||:|.|.|.|.|.|:.|...|    |.|     .:|..|.||:
Human    30 SPPQILVHPQDQLFQGPGPARMSCQASGQPPPTIRWLLNGQPL----SMVPPDPHHLLPDGTLLL 90

  Fly   558 -----------SNIRSVDAGLYICVRANEAG-SVKGEAYLSVLVRTQIIQ-PPVDTTVLLGLTAT 609
                       ....|.|.|:|.|..:|..| :|...|.|||.|..:..| .|.|...::|...|
Human    91 LQPPARGHAHDGQALSTDLGVYTCEASNRLGTAVSRGARLSVAVLREDFQIQPRDMVAVVGEQFT 155

  Fly   610 LQCKVSSDPSVPYNIDWYREGQSSTPISNSQRIGVQADGQLEIQAVRASDVGSYACVVT-SPGGN 673
            |:|........| .:.|:::|:   |::........:.|.|.:.....||.|:|.||.| |.|..
Human   156 LECGPPWGHPEP-TVSWWKDGK---PLALQPGRHTVSGGSLLMARAEKSDEGTYMCVATNSAGHR 216

  Fly   674 ETRAARLSVIELPFPPSNVKVERLPEPQQRSINVSWTPGFDGNSPISKFI--IQRREVSEL---- 732
            |:||||:|:               .|||            |...|:....  ||...|:.|    
Human   217 ESRAARVSI---------------QEPQ------------DYTEPVELLAVRIQLENVTLLNPDP 254

  Fly   733 --GPVPDPLLNWITELSNVSADQRWILLENLKAATVYQFRVSAVNRVGEGSPSEPSNVVELPQEA 795
              ||.|.|.: |::          |              :||     |..:|::....:...|.|
Human   255 AEGPKPRPAV-WLS----------W--------------KVS-----GPAAPAQSYTALFRTQTA 289

  Fly   796 PSGPPVGFVGSARSMSEIITQWQPPLEEHRNGQILGYILRYRLFGYNNVPWSYQNITNEAQRNFL 860
            |.|.      .|....|::..||       :.::.|                             
Human   290 PGGQ------GAPWAEELLAGWQ-------SAELGG----------------------------- 312

  Fly   861 IQELITW-KDYIVQIAAYNNMGVGVYTEGSKIKTKEGVPEAPPTNVKVEAINSTAARCRWTPPNP 924
                :.| :||..::...:....|..:....::..|.||.|||..|.::..|.|.. ..|.||..
Human   313 ----LHWGQDYEFKVRPSSGRARGPDSNVLLLRLPEKVPSAPPQEVTLKPGNGTVF-VSWVPPPA 372

  Fly   925 QQINGINQGYKIQAWQRRLIDGEWRDIERRMKTVPPSLIDPLAEQTAILGGLEKFTEYNISVLCF 989
            :..|||.:||  |.|..    |.        .::||:....:.|||.:.........|.:.|...
Human   373 ENHNGIIRGY--QVWSL----GN--------TSLPPANWTVVGEQTQLEIATHMPGSYCVQVAAV 423

  Fly   990 TDPGDGVASSQVAVM 1004
            |..|.|..|..|.::
Human   424 TGAGAGEPSRPVCLL 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sdkNP_001284756.1 Ig_3 72..142 CDD:464046
Ig 280..344 CDD:409353
Ig strand B 280..283 CDD:409353
Ig strand C 292..298 CDD:409353
Ig strand E 319..323 CDD:409353
Ig strand F 333..338 CDD:409353
Ig 360..451 CDD:472250
Ig strand B 378..382 CDD:409353
Ig strand C 391..395 CDD:409353
Ig strand E 416..420 CDD:409353
Ig strand F 430..435 CDD:409353
Ig strand G 443..446 CDD:409353
Ig 502..587 CDD:472250 29/101 (29%)
Ig strand B 517..521 CDD:409353 1/3 (33%)
Ig strand C 530..534 CDD:409353 1/3 (33%)
Ig strand E 554..557 CDD:409353 1/2 (50%)
Ig strand F 567..572 CDD:409353 2/4 (50%)
Ig strand G 580..583 CDD:409353 0/2 (0%)
Ig 592..682 CDD:472250 27/91 (30%)
Ig strand B 608..612 CDD:409353 2/3 (67%)
Ig strand C 623..627 CDD:409353 0/3 (0%)
Ig strand E 648..652 CDD:409353 2/3 (67%)
Ig strand F 662..667 CDD:409353 2/4 (50%)
Ig strand G 675..678 CDD:409353 1/2 (50%)
FN3 686..789 CDD:238020 19/110 (17%)
FN3 798..893 CDD:238020 10/95 (11%)
FN3 901..1005 CDD:238020 28/104 (27%)
FN3 <960..>1261 CDD:442628 11/45 (24%)
fn3 1317..1402 CDD:394996
FN3 1415..1507 CDD:238020
FN3 1513..1608 CDD:238020
FN3 1583..>2011 CDD:442628
ROBO4NP_061928.4 Ig 32..133 CDD:472250 31/104 (30%)
Ig strand B 49..53 CDD:409353 1/3 (33%)
Ig strand C 62..66 CDD:409353 1/3 (33%)
Ig strand F 111..116 CDD:409353 2/4 (50%)
Ig strand G 125..128 CDD:409353 0/2 (0%)
IgI_2_Robo 140..225 CDD:409389 27/88 (31%)
Ig strand A 140..143 CDD:409389 1/2 (50%)
Ig strand A' 145..149 CDD:409389 1/3 (33%)
Ig strand B 153..160 CDD:409389 3/6 (50%)
Ig strand C 168..173 CDD:409389 1/4 (25%)
Ig strand C' 175..178 CDD:409389 1/5 (20%)
Ig strand D 183..187 CDD:409389 0/3 (0%)
Ig strand E 190..196 CDD:409389 2/5 (40%)
Ig strand F 203..211 CDD:409389 4/7 (57%)
Ig strand G 214..225 CDD:409389 6/10 (60%)
fn3 350..432 CDD:394996 26/96 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 531..551
PHA03247 <567..876 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 713..793
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 806..826
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 971..1007
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.