DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sdk and CNTN5

DIOPT Version :10

Sequence 1:NP_001284756.1 Gene:sdk / 31017 FlyBaseID:FBgn0021764 Length:2265 Species:Drosophila melanogaster
Sequence 2:NP_055176.1 Gene:CNTN5 / 53942 HGNCID:2175 Length:1100 Species:Homo sapiens


Alignment Length:1187 Identity:299/1187 - (25%)
Similarity:470/1187 - (39%) Gaps:187/1187 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KSAASSL--RRRRPK--TTITATLAIEMPSQPKLASLLAVLVLLCYCDSCFFCYADANLQQQNSI 63
            ||::|||  .:.||:  :....||:...||               :..:....|:..||...:..
Human    39 KSSSSSLFGSKTRPRYSSPSLGTLSASSPS---------------WLGAAQNYYSPINLYHSSDA 88

  Fly    64 VQQQQL--QAPRFTTHPSSSGSIVSEGSTKI-LQCHALGYPQPTYRWLKDGVPVGDFSSSQFYRF 125
            .:|.:.  ..|.|...|............|: |.|...|.|.|:||||::|..: |..|.  ||:
Human    89 FKQDESVDYGPVFVQEPDDIIFPTDSDEKKVALNCEVRGNPVPSYRWLRNGTEI-DLESD--YRY 150

  Fly   126 ----------HSTRREDAGSYQCIARNDAGSIFSEKSDVVVAYMGIFENTTEGRLTVISGHPAIF 180
                      :.:..:|:|.|||:|.|..|||.|.::.:..||:|.|...|...::|..|...:.
Human   151 SLIDGTFIISNPSEAKDSGHYQCLATNTVGSILSREATLQFAYLGNFSGRTRSAVSVREGQGVVL 215

  Fly   181 DMPPIESIPVPSVMWQSEDGP---LNYDIKYAFTHANQLIILSADENDRKGYRAKAINTQLGKEE 242
            ...|....|.....|...:.|   .....::.......|.|.....:|...|.....||......
Human   216 MCSPPPHSPEIIYSWVFNEFPSFVAEDSRRFISQETGNLYISKVQTSDVGSYICLVKNTVTNARV 280

  Fly   243 SSAFVHLNVSGDPYI-EVAPEIIVR-PQDVKVKVGTGVVELQCIANARPLHELETLWLK-DGLAV 304
            .|....|.:..|..: |..|:|.|. |..|....|| .|:::|.|...|:..:  .|:| :|...
Human   281 LSPPTPLTLRNDGVMGEYEPKIEVHFPFTVTAAKGT-TVKMECFALGNPVPTI--TWMKVNGYIP 342

  Fly   305 ETAGVRHTLNDPWNRTLALLQANSSHSGEYTCQVRLRSGGYPAVSASARLQILEPPLFFTPMRAE 369
            ..|.:|.:     ...|.:.......:|.|.|:.....|   ..|...:||:...|.:...:. :
Human   343 SKARLRKS-----QAVLEIPNVQLDDAGIYECRAENSRG---KNSFRGQLQVYTYPHWVEKLN-D 398

  Fly   370 TFGEFGGQVQLTCDVVGEPTPQVKWFRNAE--SVDAHIESGRYTLNTDNTLVIKKLILDDAAMFQ 432
            |..:.|..::..|...|:|.|..:|.:|..  |..:.:|.      .:..|:|..:...||.|:|
Human   399 TQLDSGSPLRWECKATGKPRPTYRWLKNGVPLSPQSRVEM------VNGVLMIHNVNQSDAGMYQ 457

  Fly   433 CLAINEAGENSASTWLRVKTKTAKNRVKRLAQPRILRVRASHAGLGSEKGSESGSSDRRKEFRFA 497
            |||.|:.|...||..|::                                             .|
Human   458 CLAENKYGAIYASAELKI---------------------------------------------LA 477

  Fly   498 SAPIMELPPQNVTALDGKD--ATISCRAVGSPNPNITWIYNETQLVDISSRVQILESGDLLISNI 560
            |||...|.....|.:..||  ..|.|:..|||.|.|:|...: :.|..:.|:.||..|.|.|.|.
Human   478 SAPTFALNQLKKTIIVTKDQEVVIECKPQGSPKPTISWKKGD-RAVRENKRIAILPDGSLRILNA 541

  Fly   561 RSVDAGLYICVRANEAGSVKGEAYLSVLVRTQIIQPPVDTTVLLGLTATLQCKVSSDPSVPYNID 625
            ...|.|.|:|...|..||.:..|.|||...|:|...|..|.:.:|.:..|.||...|.|:.....
Human   542 SKSDEGKYVCRGENVFGSAEIIASLSVKEPTRIELTPKRTELTVGESIVLNCKAIHDASLDVTFY 606

  Fly   626 WYREGQSSTPI------SNSQRIGVQA-DGQLEIQAVRASDVGSYACVVTSPGGNETRAARLSVI 683
            |..:||   ||      .:.:.|..|| ...|.|:.:.....|.|.|.|.:...:.:..|.|.|.
Human   607 WTLKGQ---PIDFEEEGGHFESIRAQASSADLMIRNILLMHAGRYGCRVQTTADSVSDEAELLVR 668

  Fly   684 ELPFPPSNVKVERLPEPQQRSINVSWTPGFDGNSPISKFIIQRREVSELGPVPDPLLNW-----I 743
            ..|.||..|.||.:.|   .:..:||:|..|.:||||.:.:|.|....||        |     :
Human   669 GPPGPPGIVIVEEITE---STATLSWSPAADNHSPISSYNLQARSPFSLG--------WQTVKTV 722

  Fly   744 TELSNVSADQRWILLENLKAATVYQFRVSAVNRVGEGSPSEPSNVVELPQEAPSGPPVGFVGSAR 808
            .|:  ::.|....:..:|.....|:|||.|.|.:|.|.||.||.::...:..|...|....|.:.
Human   723 PEI--ITGDMESAMAVDLNPWVEYEFRVVATNPIGTGDPSTPSRMIRTNEAVPKTAPTNVSGRSG 785

  Fly   809 SMSEIITQWQPPLEEHRNGQILGYILRYRLFGYNNVPWSYQNITNEAQRNFLIQE--LITWKDYI 871
            ...|::..|:|..||.:||:..|||:.:|..|...  |..:.:|:.....|:.::  :.....:.
Human   786 RRHELVIAWEPVSEEFQNGEGFGYIVAFRPNGTRG--WKEKMVTSSEASKFIYRDESVPPLTPFE 848

  Fly   872 VQIAAYNNMGVGVYTEGSKIKTKEGVPEAPPTNVKVEAINSTAARCRWTPPNPQQINGINQGYKI 936
            |::..|||.|.|.:::...|.:.||.|.|.||:||..:::.:.....|  .:.::..|..||:::
Human   849 VKVGVYNNKGDGPFSQIVVICSAEGEPSAAPTDVKATSVSVSEILVAW--KHIKESLGRPQGFEV 911

  Fly   937 QAWQRRLIDGEWRDIERRMKTVPPSLIDPLAEQTAILGGLEKFTEYNISVLCFTDPGDGVASSQV 1001
            ..|:    |.|..|....:||..       .|...||.|||..|.|:.:|..:...|.|..||:|
Human   912 GYWK----DMEQEDTAETVKTRG-------NESFVILTGLEGNTLYHFTVRAYNGAGYGPPSSEV 965

  Fly  1002 AVMTMDDVPDEV-TGLHFDDVSDRSVKVLWAP--PRASNGILTGYTVRYQVKDRPDTLKSFNLTA 1063
            :..|....|.:. :.|.::....: |.:.|.|  |.|:...:.||.|.|:.:..          :
Human   966 SATTKKSPPSQAPSNLRWEQQGSQ-VSLGWEPVIPLANESEVVGYKVFYRQEGH----------S 1019

  Fly  1064 DDTELTVNQLQATTH------YWFEIVAWTRVGSGIPKTATIQSGVEPVLPHAPTALALSNIEAF 1122
            :...:...:|||...      |..|:.|::..|.|   ||:.|..| |.........|.|.:.:.
Human  1020 NSQVIETQKLQAVVPLPDAGVYIIEVRAYSEGGDG---TASSQIRV-PSYSGGKITSAQSTLHSL 1080

  Fly  1123 SVVLQFTPGFDGNSSIT 1139
            |.         .:||:|
Human  1081 ST---------SSSSVT 1088

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sdkNP_001284756.1 Ig_3 72..142 CDD:464046 24/80 (30%)
Ig 280..344 CDD:409353 12/64 (19%)
Ig strand B 280..283 CDD:409353 0/2 (0%)
Ig strand C 292..298 CDD:409353 0/5 (0%)
Ig strand E 319..323 CDD:409353 1/3 (33%)
Ig strand F 333..338 CDD:409353 2/4 (50%)
Ig 360..451 CDD:472250 25/92 (27%)
Ig strand B 378..382 CDD:409353 0/3 (0%)
Ig strand C 391..395 CDD:409353 0/3 (0%)
Ig strand E 416..420 CDD:409353 1/3 (33%)
Ig strand F 430..435 CDD:409353 3/4 (75%)
Ig strand G 443..446 CDD:409353 1/2 (50%)
Ig 502..587 CDD:472250 29/86 (34%)
Ig strand B 517..521 CDD:409353 1/3 (33%)
Ig strand C 530..534 CDD:409353 1/3 (33%)
Ig strand E 554..557 CDD:409353 1/2 (50%)
Ig strand F 567..572 CDD:409353 2/4 (50%)
Ig strand G 580..583 CDD:409353 0/2 (0%)
Ig 592..682 CDD:472250 25/96 (26%)
Ig strand B 608..612 CDD:409353 1/3 (33%)
Ig strand C 623..627 CDD:409353 0/3 (0%)
Ig strand E 648..652 CDD:409353 1/3 (33%)
Ig strand F 662..667 CDD:409353 2/4 (50%)
Ig strand G 675..678 CDD:409353 0/2 (0%)
FN3 686..789 CDD:238020 35/107 (33%)
FN3 798..893 CDD:238020 24/96 (25%)
FN3 901..1005 CDD:238020 28/103 (27%)
FN3 <960..>1261 CDD:442628 45/189 (24%)
fn3 1317..1402 CDD:394996
FN3 1415..1507 CDD:238020
FN3 1513..1608 CDD:238020
FN3 1583..>2011 CDD:442628
CNTN5NP_055176.1 IgI_1_Contactin-5 98..193 CDD:409435 29/97 (30%)
Ig strand A 100..104 CDD:409435 1/3 (33%)
Ig strand A' 107..112 CDD:409435 0/4 (0%)
Ig strand B 118..126 CDD:409435 3/7 (43%)
Ig strand C 131..137 CDD:409435 4/5 (80%)
Ig strand C' 139..142 CDD:409435 1/2 (50%)
Ig strand D 149..153 CDD:409435 1/3 (33%)
Ig strand E 155..161 CDD:409435 0/5 (0%)
Ig strand F 168..177 CDD:409435 5/8 (63%)
Ig strand G 180..193 CDD:409435 4/12 (33%)
Ig 202..287 CDD:472250 13/84 (15%)
Ig strand B 213..217 CDD:409392 0/3 (0%)
Ig strand C 227..231 CDD:409392 0/3 (0%)
Ig strand E 252..256 CDD:409392 1/3 (33%)
Ig strand F 266..271 CDD:409392 1/4 (25%)
Ig strand G 282..285 CDD:409392 1/2 (50%)
Ig 300..387 CDD:472250 24/97 (25%)
Ig strand B 318..322 CDD:409357 1/3 (33%)
Ig strand C 331..335 CDD:409357 0/5 (0%)
Ig strand E 352..356 CDD:409357 1/3 (33%)
Ig strand F 366..371 CDD:409357 2/4 (50%)
Ig strand G 379..382 CDD:409357 1/2 (50%)
Ig 392..475 CDD:472250 24/89 (27%)
Ig strand B 407..411 CDD:409353 0/3 (0%)
Ig strand C 420..424 CDD:409353 0/3 (0%)
Ig strand E 441..445 CDD:409353 1/3 (33%)
Ig strand F 455..460 CDD:409353 3/4 (75%)
Ig strand G 468..471 CDD:409353 1/2 (50%)
Ig5_Contactin 480..568 CDD:409358 30/88 (34%)
Ig strand A 480..485 CDD:409358 1/4 (25%)
Ig strand A' 488..493 CDD:409358 1/4 (25%)
Ig strand B 497..504 CDD:409358 1/6 (17%)
Ig strand C 512..516 CDD:409358 1/3 (33%)
Ig strand D 530..533 CDD:409358 2/2 (100%)
Ig strand E 534..539 CDD:409358 2/4 (50%)
Ig strand F 547..555 CDD:409358 3/7 (43%)
Ig strand G 561..568 CDD:409358 2/6 (33%)
Ig 570..671 CDD:472250 27/103 (26%)
Ig strand B 589..593 CDD:409359 1/3 (33%)
Ig strand C 604..608 CDD:409359 0/3 (0%)
Ig strand E 633..637 CDD:409359 1/3 (33%)
Ig strand F 647..652 CDD:409359 2/4 (50%)
Ig strand G 660..663 CDD:409359 0/2 (0%)
FN3 671..768 CDD:238020 35/109 (32%)
FN3 <718..>1023 CDD:442628 84/332 (25%)
FN3 878..969 CDD:238020 28/103 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 959..982 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.