Sequence 1: | NP_001284756.1 | Gene: | sdk / 31017 | FlyBaseID: | FBgn0021764 | Length: | 2265 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_652462.3 | Gene: | dpr12 / 50320 | FlyBaseID: | FBgn0085414 | Length: | 326 | Species: | Drosophila melanogaster |
Alignment Length: | 241 | Identity: | 52/241 - (21%) |
---|---|---|---|
Similarity: | 85/241 - (35%) | Gaps: | 46/241 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 481 KGSESGSSDRRKEFRFASAPIM---ELPPQNVTALDGKDATISCRAVGSPNPNITWIYNETQLVD 542
Fly 543 ISSR-VQILESGDLLISN---------------------IRSVDAGLYICVRANEAGSVKGEAYL 585
Fly 586 SVLVRTQIIQPPVDTTVLLGLTATLQCKVSSDPSVPYNIDWYREGQSSTPISNSQRI------GV 644
Fly 645 QADGQLEIQAVRASDVGSYAC-----------VVTSPGGNETRAAR 679 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sdk | NP_001284756.1 | Ig | 71..157 | CDD:299845 | |
I-set | 72..150 | CDD:254352 | |||
Ig | 172..245 | CDD:299845 | |||
IG_like | 280..356 | CDD:214653 | |||
Ig | 280..343 | CDD:299845 | |||
IG_like | 375..450 | CDD:214653 | |||
Ig | 378..447 | CDD:143165 | |||
Ig | 506..587 | CDD:299845 | 22/102 (22%) | ||
IG_like | 506..587 | CDD:214653 | 22/102 (22%) | ||
I-set | 592..682 | CDD:254352 | 22/105 (21%) | ||
Ig | 595..682 | CDD:299845 | 21/102 (21%) | ||
FN3 | 686..789 | CDD:238020 | |||
FN3 | 798..893 | CDD:238020 | |||
FN3 | 901..1005 | CDD:238020 | |||
fn3 | 1011..1094 | CDD:278470 | |||
FN3 | 1108..1202 | CDD:238020 | |||
FN3 | 1210..1308 | CDD:238020 | |||
fn3 | 1317..1402 | CDD:278470 | |||
FN3 | 1415..1507 | CDD:238020 | |||
FN3 | 1513..1608 | CDD:238020 | |||
fn3 | 1617..1708 | CDD:278470 | |||
FN3 | 1722..1823 | CDD:238020 | |||
FN3 | 1828..1920 | CDD:238020 | |||
FN3 | 1927..2016 | CDD:238020 | |||
dpr12 | NP_652462.3 | IG | 86..183 | CDD:214652 | 22/100 (22%) |
Ig_3 | 193..271 | CDD:404760 | 16/77 (21%) | ||
Ig strand B | 204..208 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 219..223 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 250..254 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 264..269 | CDD:409353 | 2/4 (50%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |