DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sdk and DIP-zeta

DIOPT Version :9

Sequence 1:NP_001284756.1 Gene:sdk / 31017 FlyBaseID:FBgn0021764 Length:2265 Species:Drosophila melanogaster
Sequence 2:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster


Alignment Length:375 Identity:85/375 - (22%)
Similarity:145/375 - (38%) Gaps:73/375 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   338 VRLRSGGYPAVSASARLQILEPPLFFTPMRAETFGEFGGQVQLTCDVVGEPTPQVKWFRNAESVD 402
            |.:..||....:::..:.:.||.  ||..........|..|:|.|.|....:.:|.|....:|..
  Fly    92 VIVAGGGANVPTSNLNIVVEEPE--FTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAI 154

  Fly   403 AHIESGRYTLNTDNTLVIKKLILDDAAMFQCLAINEAGENSASTWL-RVKTKTAKNR---VKRLA 463
            ..:.:...|.|...::...|   .|......|.||...|.....:: ::.|.|||.:   :..:.
  Fly   155 LTVHNHVITRNPRISVTHDK---HDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVV 216

  Fly   464 QPRILRVRASHAGLGSEKGSESGSSDRRKEFRFASAPIMELPPQNVTALDGKDATISCRAVGSPN 528
            .|.|               .:|.||                  .:|...:|.:.::.|||.|||.
  Fly   217 PPNI---------------DDSLSS------------------SDVIVREGANISLRCRASGSPR 248

  Fly   529 PNITWIYNETQLVDISSRVQILE-SGDLL-ISNIRSVDAGLYICVRANEA-GSVKGEAYLSV--- 587
            |.|.|..::...:.|:....:.| .||.| |:.|..:|.|.|:|:.:|.. .:|.....:||   
  Fly   249 PIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGVPPTVSKRIKVSVDFP 313

  Fly   588 ---LVRTQIIQPPVDTTVLLGLTATLQCKVSSDPSVPYNIDWYREGQSSTPISNSQRIGVQA--- 646
               |:..|::..|.      |...|::|...:.|:   :::::..|:... |.:|.:..|:|   
  Fly   314 PMLLIPHQLVGAPE------GFNVTIECFTEAHPT---SLNYWTRGEGPI-IHDSHKYKVEATVG 368

  Fly   647 ------DGQLEIQAVRASDVGSYACVVTSPGGNETRAARLSVIELPFPPS 690
                  ..:|.|..|.:.|.|.|.||..:|.|......||.|   .:||:
  Fly   369 LPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYV---SYPPT 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sdkNP_001284756.1 Ig 71..157 CDD:299845
I-set 72..150 CDD:254352
Ig 172..245 CDD:299845
IG_like 280..356 CDD:214653 3/17 (18%)
Ig 280..343 CDD:299845 1/4 (25%)
IG_like 375..450 CDD:214653 16/75 (21%)
Ig 378..447 CDD:143165 15/68 (22%)
Ig 506..587 CDD:299845 24/83 (29%)
IG_like 506..587 CDD:214653 24/83 (29%)
I-set 592..682 CDD:254352 23/98 (23%)
Ig 595..682 CDD:299845 22/95 (23%)
FN3 686..789 CDD:238020 2/5 (40%)
FN3 798..893 CDD:238020
FN3 901..1005 CDD:238020
fn3 1011..1094 CDD:278470
FN3 1108..1202 CDD:238020
FN3 1210..1308 CDD:238020
fn3 1317..1402 CDD:278470
FN3 1415..1507 CDD:238020
FN3 1513..1608 CDD:238020
fn3 1617..1708 CDD:278470
FN3 1722..1823 CDD:238020
FN3 1828..1920 CDD:238020
FN3 1927..2016 CDD:238020
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 20/98 (20%)
Ig 130..200 CDD:143165 15/72 (21%)
I-set 226..310 CDD:254352 25/101 (25%)
IGc2 233..298 CDD:197706 22/64 (34%)
Ig 313..410 CDD:299845 24/106 (23%)
IG_like 325..410 CDD:214653 22/94 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.