DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sdk and fipi

DIOPT Version :9

Sequence 1:NP_001284756.1 Gene:sdk / 31017 FlyBaseID:FBgn0021764 Length:2265 Species:Drosophila melanogaster
Sequence 2:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster


Alignment Length:482 Identity:115/482 - (23%)
Similarity:182/482 - (37%) Gaps:128/482 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   392 VKWFRNAESVD---AHIESGRYTLNTDNTLVIKKLILDDAAMFQCLAINEAGENSASTWLRVKTK 453
            |.|..:.||:.   |.....|||              :::.:.||        .|....:.:..|
  Fly    16 VAWANHHESLSLSPAEHSVVRYT--------------NESLIVQC--------RSPDPKVELHWK 58

  Fly   454 TAKNRVKRLAQPRI---------LRVRASHAGLGSEKGSES----GSSDRRKEFRF--------- 496
            :.|..:.|..:.||         |::..:|..| ::||:.|    ..|...|.|..         
  Fly    59 SPKGEIIREHKGRIHIEQTSTEQLKIVFAHIAL-ADKGNWSCEAADGSLHSKSFDLIVYQKITFT 122

  Fly   497 ASAPIMELPPQNVTALDGKDATISCRAVGSPNPNITWIYNETQL----VDISSRVQILESGDLLI 557
            .:|.:|       |..:|:.|||.|...|.|.||:||.:|...:    .| .|:.:||..| |||
  Fly   123 ENATVM-------TVKEGEKATILCEVKGEPQPNVTWHFNGQPISAGAAD-DSKFRILADG-LLI 178

  Fly   558 SNIRSVDAGLYICVRANEAGSVKGEAY-LSVLVRTQIIQPPVDTTVLLGL-------TATLQCKV 614
            :.:...|.|.|.| ||.:..|:..:.. .:||::.: .:|....|..:.|       ||||.|:.
  Fly   179 NKVTQNDTGEYAC-RAYQVNSIASDMQERTVLMKIE-HKPIWSKTPFVSLKYAYINGTATLMCEA 241

  Fly   615 SSDPSVPYNIDWYREGQSSTPISNSQRIGVQAD---GQLEIQAVRASDVGSYACVVTSPGGNETR 676
            .::|  |.|..|||:.....  ||::...:|:|   ..|.|..:..|...:|.|...:..|...|
  Fly   242 LAEP--PANFTWYRKHNKLH--SNNRLYTIQSDSYWSSLTIHVLNTSAFDNYRCRARNDLGTIER 302

  Fly   677 AARLSVIELPFPPSNVKVERLPEPQQRSINVSWTPGFDGNSPISKFIIQRREVSELGPVPDPL-- 739
            ..||...|.|..|:|.::.                ||:.|:........|      ||...|:  
  Fly   303 TTRLEQGEKPPSPANFQLR----------------GFNSNTFDVVLSAPR------GPPDSPMGV 345

  Fly   740 ----LNWITELSNVSADQRW---------------ILLENLKAATVYQFRVSAVNRVG--EGSPS 783
                :.::||:...:...:|               .||.||:..|||..|.::.|..|  :.:..
  Fly   346 NGFRIEYMTEMEFKTDAGKWTNARRKDYAFEEGATFLLTNLEPDTVYLVRAASRNLAGFSDFTKV 410

  Fly   784 EPSNVVELPQEAPSGPPVGFVGSARSM 810
            |....:.|.....||     |...|:|
  Fly   411 EKYKTLSLEPRVSSG-----VKETRNM 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sdkNP_001284756.1 Ig 71..157 CDD:299845
I-set 72..150 CDD:254352
Ig 172..245 CDD:299845
IG_like 280..356 CDD:214653
Ig 280..343 CDD:299845
IG_like 375..450 CDD:214653 11/60 (18%)
Ig 378..447 CDD:143165 11/57 (19%)
Ig 506..587 CDD:299845 28/85 (33%)
IG_like 506..587 CDD:214653 28/85 (33%)
I-set 592..682 CDD:254352 27/99 (27%)
Ig 595..682 CDD:299845 27/96 (28%)
FN3 686..789 CDD:238020 24/125 (19%)
FN3 798..893 CDD:238020 4/13 (31%)
FN3 901..1005 CDD:238020
fn3 1011..1094 CDD:278470
FN3 1108..1202 CDD:238020
FN3 1210..1308 CDD:238020
fn3 1317..1402 CDD:278470
FN3 1415..1507 CDD:238020
FN3 1513..1608 CDD:238020
fn3 1617..1708 CDD:278470
FN3 1722..1823 CDD:238020
FN3 1828..1920 CDD:238020
FN3 1927..2016 CDD:238020
fipiNP_787975.1 IG_like 33..115 CDD:214653 20/104 (19%)
I-set 128..202 CDD:254352 29/83 (35%)
Ig 133..>193 CDD:299845 24/62 (39%)
IG_like 228..307 CDD:214653 23/82 (28%)
Ig 235..305 CDD:143165 21/73 (29%)
FN3 312..415 CDD:238020 24/124 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.