DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sdk and dpr18

DIOPT Version :9

Sequence 1:NP_001284756.1 Gene:sdk / 31017 FlyBaseID:FBgn0021764 Length:2265 Species:Drosophila melanogaster
Sequence 2:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster


Alignment Length:345 Identity:66/345 - (19%)
Similarity:117/345 - (33%) Gaps:105/345 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   434 LAINEAGENSASTWLRVKTKT-AKNRVKR--LAQP-RILRVRASHAGLGSEKGSESGSSDRRKEF 494
            |.|...|.....|.:.:.|.. |..:|.|  :.|| ...|.|......|..:.:|...|....|.
  Fly   149 LPIKNVGTTDQLTTVTMPTTAFASLKVDRSTMKQPIDSTRTRNHWTASGFARVTERPRSKHHHEH 213

  Fly   495 RFASAPIMELPPQNVTALDG--------KDATISCRAVGSPNPNITWIYNETQLVDISSRVQILE 551
            .:  .|..|.|..:.|:.|.        .:|.::||.....:..:.|:....:.|.:.:...:..
  Fly   214 HW--GPFFEEPINSATSGDNLVSAVHLFTEAVLNCRVGMLKDKTVMWVRRTAEKVSLLTVGNVTY 276

  Fly   552 SGD--------------LLISNIRSVDAGLYICVRANEAGSVKGEAYLSVLVRTQIIQPPV---- 598
            |||              |||:..::.|||:|:|..:.....|       ......:::||:    
  Fly   277 SGDPRIRVKFQYPNNWRLLINPTQTEDAGVYMCQVSTHPPRV-------FTTNLTVLEPPLRIID 334

  Fly   599 -------DTTVLLGLTATLQCKVS------------------------------SDPSVPYNID- 625
                   |.....|.|..|||::|                              |:.::..|:: 
  Fly   335 EHERDVGDRYYKSGSTVDLQCQISRSFFQKERQTILKSTDSANDAVQKLINETTSELNLIGNVNQ 399

  Fly   626 -------------------WYREGQSSTPISNSQRIGVQ---ADGQLEIQAVRASDVGSYACVVT 668
                               |.::.:....::| :|:.|.   ...::.|...:.||.|:|:|   
  Fly   400 TQHKFSGQDLEKYFTKFITWAKDEEPLQGMTN-RRLSVSDVWLTSRISIGDAKLSDSGNYSC--- 460

  Fly   669 SPGGNETRAARLSVI--ELP 686
            |.|...|...::.|:  |||
  Fly   461 SLGRLFTVIVQVQVLTGELP 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sdkNP_001284756.1 Ig 71..157 CDD:299845
I-set 72..150 CDD:254352
Ig 172..245 CDD:299845
IG_like 280..356 CDD:214653
Ig 280..343 CDD:299845
IG_like 375..450 CDD:214653 4/15 (27%)
Ig 378..447 CDD:143165 3/12 (25%)
Ig 506..587 CDD:299845 19/102 (19%)
IG_like 506..587 CDD:214653 19/102 (19%)
I-set 592..682 CDD:254352 24/153 (16%)
Ig 595..682 CDD:299845 24/150 (16%)
FN3 686..789 CDD:238020 1/1 (100%)
FN3 798..893 CDD:238020
FN3 901..1005 CDD:238020
fn3 1011..1094 CDD:278470
FN3 1108..1202 CDD:238020
FN3 1210..1308 CDD:238020
fn3 1317..1402 CDD:278470
FN3 1415..1507 CDD:238020
FN3 1513..1608 CDD:238020
fn3 1617..1708 CDD:278470
FN3 1722..1823 CDD:238020
FN3 1828..1920 CDD:238020
FN3 1927..2016 CDD:238020
dpr18NP_573102.1 IG_like 242..325 CDD:214653 17/89 (19%)
Ig <258..326 CDD:299845 14/74 (19%)
IGc2 <417..461 CDD:197706 10/47 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.