| Sequence 1: | NP_001284756.1 | Gene: | sdk / 31017 | FlyBaseID: | FBgn0021764 | Length: | 2265 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_036019026.1 | Gene: | Negr1 / 320840 | MGIID: | 2444846 | Length: | 362 | Species: | Mus musculus |
| Alignment Length: | 376 | Identity: | 79/376 - (21%) |
|---|---|---|---|
| Similarity: | 127/376 - (33%) | Gaps: | 113/376 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 263 IIVRPQDVKVKVGTGVVELQCIANARPLHELETLWLKDGLA----VETAGVRHTLNDPW------ 317
Fly 318 --------NRTLALLQANSSHSGEYTCQVRLRSGGYPAVSASARLQILEPPLFFTPMRAETFGEF 374
Fly 375 GGQVQLTCDVVGEPTPQVKWFRNAESVDAHIESGRYTLNTDNTLVIKKLILDDAAMFQCLAINEA 439
Fly 440 GENSASTWLRVKTKTAKNRVKRLAQPRILRVRASHAGLGSEKGSESGSSDRRKEFRFASAPIMEL 504
Fly 505 PPQNVTALDGKDATISCRAVGSPNPNITWIYNETQLVDISSRVQILESGD---LLISNIRSVDAG 566
Fly 567 LYICVRANEAGSVKGEAYLSVLVRTQIIQP--------PVDTTVLLGLTAT 609 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| sdk | NP_001284756.1 | Ig | 71..157 | CDD:299845 | |
| I-set | 72..150 | CDD:254352 | |||
| Ig | 172..245 | CDD:299845 | |||
| IG_like | 280..356 | CDD:214653 | 14/93 (15%) | ||
| Ig | 280..343 | CDD:299845 | 13/80 (16%) | ||
| IG_like | 375..450 | CDD:214653 | 20/74 (27%) | ||
| Ig | 378..447 | CDD:143165 | 19/68 (28%) | ||
| Ig | 506..587 | CDD:299845 | 22/83 (27%) | ||
| IG_like | 506..587 | CDD:214653 | 22/83 (27%) | ||
| I-set | 592..682 | CDD:254352 | 8/26 (31%) | ||
| Ig | 595..682 | CDD:299845 | 5/23 (22%) | ||
| FN3 | 686..789 | CDD:238020 | |||
| FN3 | 798..893 | CDD:238020 | |||
| FN3 | 901..1005 | CDD:238020 | |||
| fn3 | 1011..1094 | CDD:278470 | |||
| FN3 | 1108..1202 | CDD:238020 | |||
| FN3 | 1210..1308 | CDD:238020 | |||
| fn3 | 1317..1402 | CDD:278470 | |||
| FN3 | 1415..1507 | CDD:238020 | |||
| FN3 | 1513..1608 | CDD:238020 | |||
| fn3 | 1617..1708 | CDD:278470 | |||
| FN3 | 1722..1823 | CDD:238020 | |||
| FN3 | 1828..1920 | CDD:238020 | |||
| FN3 | 1927..2016 | CDD:238020 | |||
| Negr1 | XP_036019026.1 | FR1 | 38..55 | CDD:409353 | 6/33 (18%) |
| Ig strand A' | 40..46 | CDD:409353 | 1/3 (33%) | ||
| IG_like | 41..129 | CDD:214653 | 18/110 (16%) | ||
| Ig strand B | 48..56 | CDD:409353 | 4/28 (14%) | ||
| CDR1 | 56..60 | CDD:409353 | 2/3 (67%) | ||
| FR2 | 61..68 | CDD:409353 | 0/6 (0%) | ||
| Ig strand C | 61..67 | CDD:409353 | 0/5 (0%) | ||
| CDR2 | 69..79 | CDD:409353 | 1/9 (11%) | ||
| Ig strand C' | 71..74 | CDD:409353 | 0/2 (0%) | ||
| Ig strand C' | 76..79 | CDD:409353 | 1/2 (50%) | ||
| FR3 | 80..115 | CDD:409353 | 5/34 (15%) | ||
| Ig strand D | 84..91 | CDD:409353 | 0/6 (0%) | ||
| Ig strand E | 94..100 | CDD:409353 | 1/5 (20%) | ||
| Ig strand F | 107..115 | CDD:409353 | 4/7 (57%) | ||
| CDR3 | 116..120 | CDD:409353 | 0/6 (0%) | ||
| Ig strand G | 120..129 | CDD:409353 | 1/8 (13%) | ||
| FR4 | 122..129 | CDD:409353 | 1/6 (17%) | ||
| Ig strand A' | 139..144 | CDD:409353 | 0/4 (0%) | ||
| IGc2 | 146..204 | CDD:197706 | 21/89 (24%) | ||
| Ig strand B | 150..157 | CDD:409353 | 4/6 (67%) | ||
| Ig strand C | 163..168 | CDD:409353 | 1/5 (20%) | ||
| Ig strand C' | 170..172 | CDD:409353 | 0/1 (0%) | ||
| Ig strand E | 180..186 | CDD:409353 | 3/12 (25%) | ||
| Ig strand F | 193..200 | CDD:409353 | 1/6 (17%) | ||
| Ig_3 | 219..295 | CDD:404760 | 20/78 (26%) | ||
| putative Ig strand A | 219..225 | CDD:409353 | 2/6 (33%) | ||
| Ig strand B | 235..239 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 248..252 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 274..278 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 288..293 | CDD:409353 | 2/4 (50%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||