DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sdk and dpr14

DIOPT Version :9

Sequence 1:NP_001284756.1 Gene:sdk / 31017 FlyBaseID:FBgn0021764 Length:2265 Species:Drosophila melanogaster
Sequence 2:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster


Alignment Length:326 Identity:63/326 - (19%)
Similarity:107/326 - (32%) Gaps:96/326 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 PSVMWQS-----EDGPLNYDIKYAFTHANQLIILSADENDRKGYRAKAINTQLGKEESSAFVHLN 250
            |...||.     .|.|.:.:::...|..::.....||.     |....|:|||   .||.::|..
  Fly    41 PKNFWQEFSSPFTDTPEDEELEVTETTTHEPFPFFADP-----YTTLNISTQL---SSSVYLHCR 97

  Fly   251 VSGDPYIEVAPEIIVRPQDVKVKVGTGVVELQCIANARPLHELETLWLK---DGLAVETAGVRHT 312
            |:                |::.|.                    ..|::   |.|.:.|.| :||
  Fly    98 VN----------------DLQGKT--------------------VSWMRRRGDDLTLITFG-QHT 125

  Fly   313 ----------LNDPWNRTLALLQANSSHSGEYTCQVRLRSGGYPAVSASARLQILEPPLFFTPMR 367
                      ..:|.:..|.:..||....|.|.|||    ..:|.:.....|.|:.|.:.....|
  Fly   126 YSGDSRYSLEFEEPNDWKLLIQFANERDEGPYECQV----SSHPPLVLLVYLTIIVPHVEILDER 186

  Fly   368 A----ETFGEFGGQVQLTCDV--VGEPTPQVKWFRNAESVDAHIESGRYTLNTD-------NTLV 419
            .    |.:.:.|..::|.|.:  :..|:..:.|......::.....|..::.||       :.|.
  Fly   187 GSATPEKYYKAGSTIELQCVISKIPHPSSYITWRHGPRLLNYDTSRGGISVKTDMLPGRALSRLY 251

  Fly   420 IKKLILDDAAMFQCLAINEAGENSASTWLRVKTKTAKNRVKRLAQPRILRVRASHAGLGSEKGSE 484
            |......|...:.|:..||.            |:|....|....:|..::    ||....:|.:.
  Fly   252 IANANRQDTGNYTCMLGNEI------------TETVVVHVLNGEEPAAMQ----HANGSRQKANA 300

  Fly   485 S 485
            |
  Fly   301 S 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sdkNP_001284756.1 Ig 71..157 CDD:299845
I-set 72..150 CDD:254352
Ig 172..245 CDD:299845 14/58 (24%)
IG_like 280..356 CDD:214653 18/88 (20%)
Ig 280..343 CDD:299845 16/75 (21%)
IG_like 375..450 CDD:214653 14/83 (17%)
Ig 378..447 CDD:143165 13/77 (17%)
Ig 506..587 CDD:299845
IG_like 506..587 CDD:214653
I-set 592..682 CDD:254352
Ig 595..682 CDD:299845
FN3 686..789 CDD:238020
FN3 798..893 CDD:238020
FN3 901..1005 CDD:238020
fn3 1011..1094 CDD:278470
FN3 1108..1202 CDD:238020
FN3 1210..1308 CDD:238020
fn3 1317..1402 CDD:278470
FN3 1415..1507 CDD:238020
FN3 1513..1608 CDD:238020
fn3 1617..1708 CDD:278470
FN3 1722..1823 CDD:238020
FN3 1828..1920 CDD:238020
FN3 1927..2016 CDD:238020
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 26/123 (21%)
Ig 84..169 CDD:299845 27/128 (21%)
IG_like 191..279 CDD:214653 17/99 (17%)
Ig 201..274 CDD:143165 14/84 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.