DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sdk and IGSF10

DIOPT Version :10

Sequence 1:NP_001284756.1 Gene:sdk / 31017 FlyBaseID:FBgn0021764 Length:2265 Species:Drosophila melanogaster
Sequence 2:XP_011511010.1 Gene:IGSF10 / 285313 HGNCID:26384 Length:2695 Species:Homo sapiens


Alignment Length:983 Identity:227/983 - (23%)
Similarity:373/983 - (37%) Gaps:256/983 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RPKTTITATLA----IEMPSQPKLASLLAV---LVL--LCYCDSCFF-CYADANLQQQNSIVQQQ 67
            ||..|:|..||    :...||....:::.|   |||  |...|..|: |.|.....|.:.:|:.|
Human  1844 RPSPTVTWILANQTVVSESSQGSRQAVVTVDGTLVLHNLSIYDRGFYKCVASNPGGQDSLLVKIQ 1908

  Fly    68 QLQAPRFTTHPSSSGSIVSEGSTKILQCHALGYPQPTYRW-LKDGVPVG--DFSSSQFYRF---- 125
            .:.||...........:.:.|.:..|.|.|.|.|||:..| |.||..|.  .|::|:.:.|    
Human  1909 VIAAPPVILEQRRQVIVGTWGESLKLPCTAKGTPQPSVYWVLSDGTEVKPLQFTNSKLFLFSNGT 1973

  Fly   126 ---HSTRREDAGSYQCIARNDAGSIFSEKSDVVVAYMGIFENTTEGRLTVISGHPAIFDMPPIES 187
               .:....|.|:|:|||.:..|   ||:..|::        |.|.|:|          .|.||:
Human  1974 LYIRNLASSDRGTYECIATSSTG---SERRVVML--------TMEERVT----------SPRIEA 2017

  Fly   188 I----------------------PVPSVMWQSEDGPLNYDIKY---AFTHA---NQLIILSADEN 224
            .                      |.|.:||:.....: .|.::   ::.|.   ..|.|.|..|.
Human  2018 ASQKRTEVNFGDKLLLNCSATGEPKPQIMWRLPSKAV-VDQQHRVGSWIHVYPNGSLFIGSVTEK 2081

  Fly   225 DRKGYRAKAINTQLGKEESSAFVHLNVSGDPYIEVAPEIIVRPQDVKVKVGTGV-VELQCIANAR 288
            |...|...|.| ::|.:    .:.::||    :.:.|..|...|..:.:|..|. .::.|.|:..
Human  2082 DSGVYLCVARN-KMGDD----LILMHVS----LRLKPAKIDHKQYFRKQVLHGKDFQVDCKASGS 2137

  Fly   289 PLHELETLW-LKDGLAVETA---------GVRHTLNDPWNRTLALLQANSSHSGEYTCQVRLRSG 343
            |:.|:.  | |.||..:..|         ..|:||.:  |.||...:...:..|:|||..:...|
Human  2138 PVPEIS--WSLPDGTMINNAMQADDSGHRTRRYTLFN--NGTLYFNKVGVAEEGDYTCYAQNTLG 2198

  Fly   344 ------GYPAVSASARLQILEPPLFFTPMRAETFGEFGGQVQLTCDVVGEPTPQVKWFRNAE--- 399
                  ....::|:.|::....    |..|.:.    |....|.|:|.|:|.|::.|...:.   
Human  2199 KDEMKVHLTVITAAPRIRQSNK----TNKRIKA----GDTAVLDCEVTGDPKPKIFWLLPSNDMI 2255

  Fly   400 --SVDAHIESGRYTLNTDNTLVIKKLILDDAAMFQCLAINEAGENSASTWLRVKTKTAKNRVKRL 462
              |:|      |||.:.:.:|.|.|:.|.|:..:.|:|.|.:|::         ||..|..|  :
Human  2256 SFSID------RYTFHANGSLTINKVKLLDSGEYVCVARNPSGDD---------TKMYKLDV--V 2303

  Fly   463 AQPRILRVRASHAGLGSEKGSESGSSDRRKEFRFASAPIMELPPQNVTALDGKDATISCRAVGSP 527
            ::|.::.      ||.:.:.....::.|..:..|                       .|||.|:|
Human  2304 SKPPLIN------GLYTNRTVIKATAVRHSKKHF-----------------------DCRAEGTP 2339

  Fly   528 NPNITWIYNETQLVD---ISSRVQILESGDLLISNIRSVDAGLYICVRANEAGSVKGEAYLSVL- 588
            :|.:.||..:...:.   ..||:.:.::|.|.|.|:|..|:..:|||..||.|.......|.|| 
Human  2340 SPEVMWIMPDNIFLTAPYYGSRITVHKNGTLEIRNVRLSDSADFICVARNEGGESVLVVQLEVLE 2404

  Fly   589 -VRTQIIQPPVDTTVL--LGLTATLQCKVSSDPSVPYNIDWYREGQSSTPISN---SQRIGVQAD 647
             :|....:.|.:..::  ||.:..|.|.|..:|  |..|.|..  .:.|..||   |.:..:.::
Human  2405 MLRRPTFRNPFNEKIVAQLGKSTALNCSVDGNP--PPEIIWIL--PNGTRFSNGPQSYQYLIASN 2465

  Fly   648 GQLEIQAVRASDVGSYACVVTSPGGNETRAARLSV----IELPFPPSNVK------------VER 696
            |...|......|.|.|.|...:..|...:...|.:    :.|.:.|..||            .:.
Human  2466 GSFIISKTTREDAGKYRCAARNKVGYIEKLVILEIGQKPVILTYAPGTVKGISGESLSLHCVSDG 2530

  Fly   697 LPEPQQRSINVSWTPGFDGNSPISKFIIQRREVSELGPVPDPLLNWITELSNVSADQRWILLEN- 760
            :|:|     |:.||      .| |.:::.|.::                      :.::||.:| 
Human  2531 IPKP-----NIKWT------MP-SGYVVDRPQI----------------------NGKYILHDNG 2561

  Fly   761 ---LKAATVY---QFRVSAVNRVGEGSPSEPSNVVELPQEAPSGPPVGFV---GSARSMSEI--- 813
               :|.||.|   .:...|.|.||....:.|..:|..|....:.||...|   |:|..:..:   
Human  2562 TLVIKEATAYDRGNYICKAQNSVGHTLITVPVMIVAYPPRITNRPPRSIVTRTGAAFQLHCVALG 2626

  Fly   814 -----ITQWQPPLEEHRNGQILGYILRYRLFGYNNVPWSYQNITNEAQRNFLIQELITWKDYIVQ 873
                 || |:.|  :|   .:|....:.|..|...:         ..|...:||...|....|.:
Human  2627 VPKPEIT-WEMP--DH---SLLSTASKERTHGSEQL---------HLQGTLVIQNPQTSDSGIYK 2676

  Fly   874 IAAYNNMG 881
            ..|.|.:|
Human  2677 CTAKNPLG 2684

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sdkNP_001284756.1 Ig_3 72..142 CDD:464046 23/79 (29%)
Ig 280..344 CDD:409353 20/79 (25%)
Ig strand B 280..283 CDD:409353 0/2 (0%)
Ig strand C 292..298 CDD:409353 2/6 (33%)
Ig strand E 319..323 CDD:409353 2/3 (67%)
Ig strand F 333..338 CDD:409353 3/4 (75%)
Ig 360..451 CDD:472250 24/95 (25%)
Ig strand B 378..382 CDD:409353 1/3 (33%)
Ig strand C 391..395 CDD:409353 0/3 (0%)
Ig strand E 416..420 CDD:409353 1/3 (33%)
Ig strand F 430..435 CDD:409353 1/4 (25%)
Ig strand G 443..446 CDD:409353 0/2 (0%)
Ig 502..587 CDD:472250 23/87 (26%)
Ig strand B 517..521 CDD:409353 0/3 (0%)
Ig strand C 530..534 CDD:409353 0/3 (0%)
Ig strand E 554..557 CDD:409353 1/2 (50%)
Ig strand F 567..572 CDD:409353 2/4 (50%)
Ig strand G 580..583 CDD:409353 0/2 (0%)
Ig 592..682 CDD:472250 22/94 (23%)
Ig strand B 608..612 CDD:409353 1/3 (33%)
Ig strand C 623..627 CDD:409353 1/3 (33%)
Ig strand E 648..652 CDD:409353 1/3 (33%)
Ig strand F 662..667 CDD:409353 2/4 (50%)
Ig strand G 675..678 CDD:409353 0/2 (0%)
FN3 686..789 CDD:238020 23/121 (19%)
FN3 798..893 CDD:238020 21/95 (22%)
FN3 901..1005 CDD:238020
FN3 <960..>1261 CDD:442628
fn3 1317..1402 CDD:394996
FN3 1415..1507 CDD:238020
FN3 1513..1608 CDD:238020
FN3 1583..>2011 CDD:442628
IGSF10XP_011511010.1 leucine-rich repeat 111..130 CDD:275380
LRR <120..>292 CDD:443914
leucine-rich repeat 131..154 CDD:275380
leucine-rich repeat 155..178 CDD:275380
leucine-rich repeat 179..202 CDD:275380
leucine-rich repeat 203..226 CDD:275380
leucine-rich repeat 227..250 CDD:275380
leucine-rich repeat 260..282 CDD:275380
PCC 264..>389 CDD:188093
Ig 554..627 CDD:472250
Ig strand B 565..569 CDD:409544
Ig strand C 578..583 CDD:409544
Ig strand E 606..610 CDD:409544
Ig strand F 620..625 CDD:409544
IG_like 654..734 CDD:214653
Ig strand B 663..667 CDD:409353
Ig strand C 676..680 CDD:409353
Ig strand E 700..704 CDD:409353
Ig strand F 714..719 CDD:409353
Ig strand G 728..731 CDD:409353
Herpes_BLLF1 <1365..1739 CDD:282904
Ig 1728..1812 CDD:472250
Ig strand B 1738..1742 CDD:409544
Ig strand C 1751..1755 CDD:409544
Ig strand E 1778..1782 CDD:409544
Ig strand F 1792..1797 CDD:409544
Ig strand G 1805..1808 CDD:409544
Ig 1816..1909 CDD:472250 19/64 (30%)
Ig strand B 1835..1839 CDD:409561
Ig strand C 1848..1852 CDD:409561 2/3 (67%)
Ig strand E 1875..1879 CDD:409561 1/3 (33%)
Ig strand F 1889..1894 CDD:409561 2/4 (50%)
Ig strand G 1902..1905 CDD:409561 0/2 (0%)
Ig_3 1913..1992 CDD:464046 22/78 (28%)
Ig_3 2013..2092 CDD:464046 16/79 (20%)
Ig 2122..2208 CDD:472250 22/89 (25%)
Ig strand B 2128..2132 CDD:409421 0/3 (0%)
Ig strand C 2141..2145 CDD:409421 1/5 (20%)
Ig strand E 2174..2178 CDD:409421 2/3 (67%)
Ig strand F 2188..2193 CDD:409421 3/4 (75%)
Ig strand G 2201..2204 CDD:409421 0/2 (0%)
Ig 2213..2296 CDD:472250 25/105 (24%)
Ig strand B 2231..2235 CDD:409544 1/3 (33%)
Ig strand C 2244..2248 CDD:409544 0/3 (0%)
Ig strand E 2268..2272 CDD:409544 1/3 (33%)
Ig strand F 2282..2287 CDD:409544 1/4 (25%)
Ig strand G 2295..2298 CDD:409544 2/2 (100%)
Ig <2333..2402 CDD:472250 23/68 (34%)
Ig strand C 2342..2346 CDD:409544 0/3 (0%)
Ig strand E 2368..2372 CDD:409544 2/3 (67%)
Ig strand F 2382..2387 CDD:409544 2/4 (50%)
Ig strand G 2395..2398 CDD:409544 0/2 (0%)
Ig_3 2408..2487 CDD:464046 20/82 (24%)
Ig_3 2503..2582 CDD:464046 20/112 (18%)
Ig_3 2599..2681 CDD:464046 20/96 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.