| Sequence 1: | NP_001284756.1 | Gene: | sdk / 31017 | FlyBaseID: | FBgn0021764 | Length: | 2265 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001157990.1 | Gene: | Iglon5 / 210094 | MGIID: | 2686277 | Length: | 336 | Species: | Mus musculus |
| Alignment Length: | 386 | Identity: | 95/386 - (24%) |
|---|---|---|---|
| Similarity: | 139/386 - (36%) | Gaps: | 94/386 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 344 GYPAVSASARLQILEPPLFFTPMRAETFGEFGGQVQLTCDVVGEPTPQVKWFRNAESVDAHIESG 408
Fly 409 RYTLNTDNTLVIKKLILDDAAMFQCLAINEAGENSASTWLRVKTKTAKNRVKRLAQ-PRILRVRA 472
Fly 473 SHAGLGSEKGSESGSSDRRKEFRFASAPIMELPPQ------NVTALDGKDATISCRAVGSPNPNI 531
Fly 532 TWIYNETQLVD-ISSRVQILESGDLLISNIRSVDAGLYICVRANEAGSVKGEAYLSVLVRTQIIQ 595
Fly 596 PPVDTTV-----LLGLTATLQCKVSSDPSVPYNIDWYREGQ--SSTPISNSQRIGVQAD---GQL 650
Fly 651 EIQAVRASDVGSYACVVTSPGGNETRAARLSVIELPFPPSNVK--VERLPEPQQRSINVSW 709 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| sdk | NP_001284756.1 | Ig | 71..157 | CDD:299845 | |
| I-set | 72..150 | CDD:254352 | |||
| Ig | 172..245 | CDD:299845 | |||
| IG_like | 280..356 | CDD:214653 | 2/11 (18%) | ||
| Ig | 280..343 | CDD:299845 | |||
| IG_like | 375..450 | CDD:214653 | 13/74 (18%) | ||
| Ig | 378..447 | CDD:143165 | 11/68 (16%) | ||
| Ig | 506..587 | CDD:299845 | 27/87 (31%) | ||
| IG_like | 506..587 | CDD:214653 | 27/87 (31%) | ||
| I-set | 592..682 | CDD:254352 | 26/99 (26%) | ||
| Ig | 595..682 | CDD:299845 | 26/96 (27%) | ||
| FN3 | 686..789 | CDD:238020 | 6/26 (23%) | ||
| FN3 | 798..893 | CDD:238020 | |||
| FN3 | 901..1005 | CDD:238020 | |||
| fn3 | 1011..1094 | CDD:278470 | |||
| FN3 | 1108..1202 | CDD:238020 | |||
| FN3 | 1210..1308 | CDD:238020 | |||
| fn3 | 1317..1402 | CDD:278470 | |||
| FN3 | 1415..1507 | CDD:238020 | |||
| FN3 | 1513..1608 | CDD:238020 | |||
| fn3 | 1617..1708 | CDD:278470 | |||
| FN3 | 1722..1823 | CDD:238020 | |||
| FN3 | 1828..1920 | CDD:238020 | |||
| FN3 | 1927..2016 | CDD:238020 | |||
| Iglon5 | NP_001157990.1 | Ig | 41..129 | CDD:416386 | 25/134 (19%) |
| Ig strand A' | 41..46 | CDD:409353 | 1/4 (25%) | ||
| Ig strand B | 48..56 | CDD:409353 | 2/8 (25%) | ||
| CDR1 | 56..60 | CDD:409353 | 1/3 (33%) | ||
| FR2 | 61..68 | CDD:409353 | 3/23 (13%) | ||
| Ig strand C | 61..67 | CDD:409353 | 2/22 (9%) | ||
| CDR2 | 69..79 | CDD:409353 | 4/31 (13%) | ||
| Ig strand C' | 71..74 | CDD:409353 | 1/21 (5%) | ||
| Ig strand C' | 76..79 | CDD:409353 | 0/5 (0%) | ||
| FR3 | 80..115 | CDD:409353 | 9/34 (26%) | ||
| Ig strand D | 84..91 | CDD:409353 | 3/6 (50%) | ||
| Ig strand E | 94..100 | CDD:409353 | 0/5 (0%) | ||
| Ig strand F | 107..115 | CDD:409353 | 1/7 (14%) | ||
| CDR3 | 116..120 | CDD:409353 | 1/3 (33%) | ||
| Ig strand G | 120..129 | CDD:409353 | 0/8 (0%) | ||
| FR4 | 122..129 | CDD:409353 | 0/6 (0%) | ||
| Ig strand A | 132..137 | CDD:409353 | 1/4 (25%) | ||
| Ig_3 | 134..199 | CDD:404760 | 25/73 (34%) | ||
| Ig strand A' | 140..145 | CDD:409353 | 1/4 (25%) | ||
| Ig strand B | 148..157 | CDD:409353 | 1/8 (13%) | ||
| Ig strand C | 163..167 | CDD:409353 | 2/7 (29%) | ||
| Ig strand D | 174..177 | CDD:409353 | 1/2 (50%) | ||
| Ig strand E | 178..183 | CDD:409353 | 3/9 (33%) | ||
| Ig strand F | 191..199 | CDD:409353 | 4/7 (57%) | ||
| Ig_3 | 217..295 | CDD:404760 | 23/82 (28%) | ||
| putative Ig strand A | 218..224 | CDD:409353 | 2/5 (40%) | ||
| Ig strand B | 234..238 | CDD:409353 | 2/3 (67%) | ||
| Ig strand C | 247..251 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 274..278 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 288..293 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 301..304 | CDD:409353 | 0/2 (0%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||