Sequence 1: | NP_001284756.1 | Gene: | sdk / 31017 | FlyBaseID: | FBgn0021764 | Length: | 2265 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_510069.1 | Gene: | zig-2 / 192087 | WormBaseID: | WBGene00006979 | Length: | 238 | Species: | Caenorhabditis elegans |
Alignment Length: | 231 | Identity: | 54/231 - (23%) |
---|---|---|---|
Similarity: | 85/231 - (36%) | Gaps: | 31/231 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 358 EPPLFFTPMRAETFGEFGGQVQLTCDVVGEPTPQVKWFRNAESVDAHIESGRYTLNTDNTLVIKK 422
Fly 423 LILDDAAMFQCLAINEAGENSASTWLRVKTKTAKN--RVKRLAQPRILRV-RASHAGLGSEKGSE 484
Fly 485 SGSSDRRKEFRFASAPIMELPPQNVTALDGKDATISCRAVGSPNPNITWIYNETQLVDISSRVQI 549
Fly 550 LESGDLLISNIRSVDAGLYICVRANEAGSVKGEAYL 585 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sdk | NP_001284756.1 | Ig | 71..157 | CDD:299845 | |
I-set | 72..150 | CDD:254352 | |||
Ig | 172..245 | CDD:299845 | |||
IG_like | 280..356 | CDD:214653 | |||
Ig | 280..343 | CDD:299845 | |||
IG_like | 375..450 | CDD:214653 | 17/74 (23%) | ||
Ig | 378..447 | CDD:143165 | 16/68 (24%) | ||
Ig | 506..587 | CDD:299845 | 22/80 (28%) | ||
IG_like | 506..587 | CDD:214653 | 22/80 (28%) | ||
I-set | 592..682 | CDD:254352 | |||
Ig | 595..682 | CDD:299845 | |||
FN3 | 686..789 | CDD:238020 | |||
FN3 | 798..893 | CDD:238020 | |||
FN3 | 901..1005 | CDD:238020 | |||
fn3 | 1011..1094 | CDD:278470 | |||
FN3 | 1108..1202 | CDD:238020 | |||
FN3 | 1210..1308 | CDD:238020 | |||
fn3 | 1317..1402 | CDD:278470 | |||
FN3 | 1415..1507 | CDD:238020 | |||
FN3 | 1513..1608 | CDD:238020 | |||
fn3 | 1617..1708 | CDD:278470 | |||
FN3 | 1722..1823 | CDD:238020 | |||
FN3 | 1828..1920 | CDD:238020 | |||
FN3 | 1927..2016 | CDD:238020 | |||
zig-2 | NP_510069.1 | I-set | 34..134 | CDD:254352 | 25/117 (21%) |
Ig | 34..121 | CDD:299845 | 25/104 (24%) | ||
Ig | <179..232 | CDD:299845 | 18/52 (35%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |