DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sdk and rig-3

DIOPT Version :9

Sequence 1:NP_001284756.1 Gene:sdk / 31017 FlyBaseID:FBgn0021764 Length:2265 Species:Drosophila melanogaster
Sequence 2:NP_509155.1 Gene:rig-3 / 180958 WormBaseID:WBGene00004370 Length:487 Species:Caenorhabditis elegans


Alignment Length:464 Identity:92/464 - (19%)
Similarity:158/464 - (34%) Gaps:111/464 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 LNVSGDPYIEVAPEIIVRPQDVKVKVGTGVVE------LQCIANA-RPLHELETLWLK------D 300
            ::.|..|....|..|::..:.:.....|..|.      :.|:..: ..:|:.:.||.:      |
 Worm    21 VSASDSPSSNEANPIVISSEAMDYDTNTITVREGKKLMVSCVFESDEQIHKSDLLWKQANGNNID 85

  Fly   301 G--------LAVETAGVRHTLNDPWNRTLALLQANSSHSGEYTCQVRLRSGGYPAVSASARLQIL 357
            |        :.:...|.:|.     ..:|.....::..:|.|||..  |:.|......:.:|.:|
 Worm    86 GESNPSLFSVILNEKGSKHR-----KTSLHFSSVHTRDTGLYTCTG--RTAGGENFEKTIKLVVL 143

  Fly   358 EPPLFFTPMRAETFGEFGGQVQLTCDVVG----EPTPQVKWFRNAESVDAHIESGRYTLNTDNTL 418
             |.:.:...........|..:.:.|.|.|    ||..|:. ..|.|.:|..|    :|: ..|..
 Worm   144 -PAIEWNDKDTVKGALLGEPITIDCGVKGPSGKEPMIQMT-NGNGEPLDEEI----WTI-AGNEA 201

  Fly   419 VIKKLILDDAAM-FQCLAINEAGENSASTWLRVKTKTAKNRVKRLAQPRILRVRASHAGLGSEKG 482
            .|..|..:.|.: ..|:.|....|.|...:..|..|.....|..|                    
 Worm   202 TIDSLKKEHAELTVSCITIEMHQETSKEEFPVVDRKDVNIEVYTL-------------------- 246

  Fly   483 SESGSSDRRKEFRFASAPIMELPPQNVTALDG--KDATISCRAVGS--PNPNITWIYNETQL--- 540
                     .||....:       ...|.:|.  :||.|.|....|  |..:.|:.:.:.::   
 Worm   247 ---------PEFETEES-------VQYTVIDNHVRDAIIYCNVTHSFPPVRHYTFYHGDEEIKMS 295

  Fly   541 --VDISSRVQILESGDLLISNIRSVDAGLYICVRANEAGSVKGEAYLSVLVRTQIIQPPVDTTVL 603
              .:|...|.:.:...|.|.|:...|.|.|.|    ||.::|.::|.::.:|..........|::
 Worm   296 DKFNIFVNVGVSQGAHLKIHNVNENDLGTYKC----EANNIKAKSYHTIHLREANAPAEPKVTLI 356

  Fly   604 LGLTATLQCKVSS---DPSVPYNIDWYR---------EGQSSTPISNS---------QRIGVQAD 647
            .....::..||.|   ||.:|......|         .|.|...||::         || .::.|
 Worm   357 EDKRHSIIWKVESIDRDPDLPMTAVEIRHLRAGTAEASGVSDEDISDAYWKSHSIFMQR-NIKDD 420

  Fly   648 GQLEIQAVR 656
            |..||..:|
 Worm   421 GIYEINGLR 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sdkNP_001284756.1 Ig 71..157 CDD:299845
I-set 72..150 CDD:254352
Ig 172..245 CDD:299845
IG_like 280..356 CDD:214653 16/96 (17%)
Ig 280..343 CDD:299845 14/83 (17%)
IG_like 375..450 CDD:214653 20/79 (25%)
Ig 378..447 CDD:143165 19/73 (26%)
Ig 506..587 CDD:299845 22/89 (25%)
IG_like 506..587 CDD:214653 22/89 (25%)
I-set 592..682 CDD:254352 19/86 (22%)
Ig 595..682 CDD:299845 19/83 (23%)
FN3 686..789 CDD:238020
FN3 798..893 CDD:238020
FN3 901..1005 CDD:238020
fn3 1011..1094 CDD:278470
FN3 1108..1202 CDD:238020
FN3 1210..1308 CDD:238020
fn3 1317..1402 CDD:278470
FN3 1415..1507 CDD:238020
FN3 1513..1608 CDD:238020
fn3 1617..1708 CDD:278470
FN3 1722..1823 CDD:238020
FN3 1828..1920 CDD:238020
FN3 1927..2016 CDD:238020
rig-3NP_509155.1 IG_like 48..142 CDD:214653 18/100 (18%)
Ig 267..341 CDD:319273 19/77 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.