Sequence 1: | NP_001284756.1 | Gene: | sdk / 31017 | FlyBaseID: | FBgn0021764 | Length: | 2265 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017450901.1 | Gene: | Opcml / 116597 | RGDID: | 620635 | Length: | 354 | Species: | Rattus norvegicus |
Alignment Length: | 374 | Identity: | 78/374 - (20%) |
---|---|---|---|
Similarity: | 123/374 - (32%) | Gaps: | 111/374 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 252 SGDPYIEVAPEIIVRPQDVKVKVGTGVVELQCIANARPLHELETLWLKDGLAVETAGVRHTL--- 313
Fly 314 -NDPWN---RTLALLQANSSHS-----------GEYTCQVRLRSGGYPAVSASARLQILEPPLFF 363
Fly 364 TPMRAETFGEFGGQVQLTCDVVGEPTPQVKWFRNAESVDAH--IESGRYTLNTDNTLVIKKLILD 426
Fly 427 DAAMFQCLAINEAGENSASTWLRVKTKTAKNRVKRLAQPRILRVRASHAGLGSEKGSESGSSDRR 491
Fly 492 KEFRFASAPIMELPP-----QNVTALDGKDATISCRAVGSPNPNITWIYNETQLVDISSRVQILE 551
Fly 552 SG---DLLISNIRSVDAGLYICVRANEAGSVKGEAYLSVLVRTQIIQPP 597 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sdk | NP_001284756.1 | Ig | 71..157 | CDD:299845 | |
I-set | 72..150 | CDD:254352 | |||
Ig | 172..245 | CDD:299845 | |||
IG_like | 280..356 | CDD:214653 | 21/93 (23%) | ||
Ig | 280..343 | CDD:299845 | 18/80 (23%) | ||
IG_like | 375..450 | CDD:214653 | 18/76 (24%) | ||
Ig | 378..447 | CDD:143165 | 17/70 (24%) | ||
Ig | 506..587 | CDD:299845 | 23/88 (26%) | ||
IG_like | 506..587 | CDD:214653 | 23/88 (26%) | ||
I-set | 592..682 | CDD:254352 | 1/6 (17%) | ||
Ig | 595..682 | CDD:299845 | 1/3 (33%) | ||
FN3 | 686..789 | CDD:238020 | |||
FN3 | 798..893 | CDD:238020 | |||
FN3 | 901..1005 | CDD:238020 | |||
fn3 | 1011..1094 | CDD:278470 | |||
FN3 | 1108..1202 | CDD:238020 | |||
FN3 | 1210..1308 | CDD:238020 | |||
fn3 | 1317..1402 | CDD:278470 | |||
FN3 | 1415..1507 | CDD:238020 | |||
FN3 | 1513..1608 | CDD:238020 | |||
fn3 | 1617..1708 | CDD:278470 | |||
FN3 | 1722..1823 | CDD:238020 | |||
FN3 | 1828..1920 | CDD:238020 | |||
FN3 | 1927..2016 | CDD:238020 | |||
Opcml | XP_017450901.1 | Ig | 44..132 | CDD:416386 | 24/104 (23%) |
Ig strand A' | 44..49 | CDD:409353 | 2/4 (50%) | ||
Ig strand B | 51..59 | CDD:409353 | 2/8 (25%) | ||
CDR1 | 59..63 | CDD:409353 | 1/6 (17%) | ||
FR2 | 64..70 | CDD:409353 | 1/5 (20%) | ||
Ig strand C | 64..70 | CDD:409353 | 1/5 (20%) | ||
CDR2 | 71..83 | CDD:409353 | 4/11 (36%) | ||
Ig strand C' | 72..76 | CDD:409353 | 1/3 (33%) | ||
Ig strand C' | 80..83 | CDD:409353 | 1/2 (50%) | ||
FR3 | 84..118 | CDD:409353 | 8/35 (23%) | ||
Ig strand D | 87..94 | CDD:409353 | 2/6 (33%) | ||
Ig strand E | 97..103 | CDD:409353 | 1/5 (20%) | ||
Ig strand F | 110..118 | CDD:409353 | 5/9 (56%) | ||
CDR3 | 119..123 | CDD:409353 | 0/3 (0%) | ||
Ig strand G | 123..132 | CDD:409353 | 3/9 (33%) | ||
FR4 | 125..132 | CDD:409353 | 2/7 (29%) | ||
Ig_3 | 135..206 | CDD:404760 | 21/79 (27%) | ||
Ig strand A | 135..138 | CDD:409353 | 2/2 (100%) | ||
Ig strand A' | 144..148 | CDD:409353 | 1/3 (33%) | ||
Ig strand B | 151..160 | CDD:409353 | 3/8 (38%) | ||
Ig strand C | 165..170 | CDD:409353 | 3/12 (25%) | ||
Ig strand C' | 171..174 | CDD:409353 | 1/2 (50%) | ||
Ig strand F | 198..206 | CDD:409353 | 2/7 (29%) | ||
Ig_3 | 223..300 | CDD:404760 | 21/76 (28%) | ||
putative Ig strand A | 224..230 | CDD:409353 | 1/5 (20%) | ||
Ig strand B | 240..244 | CDD:409353 | 0/3 (0%) | ||
Ig strand C | 253..257 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 279..283 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 293..298 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 306..309 | CDD:409353 | 0/2 (0%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |