DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpA and ELC1

DIOPT Version :9

Sequence 1:NP_001033818.1 Gene:SkpA / 31016 FlyBaseID:FBgn0025637 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_015279.1 Gene:ELC1 / 856061 SGDID:S000005967 Length:99 Species:Saccharomyces cerevisiae


Alignment Length:108 Identity:29/108 - (26%)
Similarity:50/108 - (46%) Gaps:14/108 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKLQSSDEEIFDTDIQIAKCSGTIKTMLEDCGMEDDENAIVPLPNVNSTILRKVLTWAHYHKDDP 68
            :.|.|.|::.::.....|..|.|:|.|:|  |...:....:.|...:|.||.|.:.:.:|:....
Yeast     6 VTLVSKDDKEYEISRSAAMISPTLKAMIE--GPFRESKGRIELKQFDSHILEKAVEYLNYNLKYS 68

  Fly    69 QPTEDDESKEKRTDDIISWDADFLKVDQGTLFELILAANYLDI 111
            ..:|||       |:|..::     :......||:|||:||.|
Yeast    69 GVSEDD-------DEIPEFE-----IPTEMSLELLLAADYLSI 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpANP_001033818.1 BTB_POZ_SKP1 4..126 CDD:349631 29/108 (27%)
Skp1 112..159 CDD:396171 29/108 (27%)
ELC1NP_015279.1 BTB_POZ_EloC 5..99 CDD:349630 28/106 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.