DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpA and SKP1

DIOPT Version :9

Sequence 1:NP_001033818.1 Gene:SkpA / 31016 FlyBaseID:FBgn0025637 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_010615.3 Gene:SKP1 / 851928 SGDID:S000002736 Length:194 Species:Saccharomyces cerevisiae


Alignment Length:191 Identity:80/191 - (41%)
Similarity:113/191 - (59%) Gaps:32/191 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SIKLQSSDEEIFDTDIQIAKCSGTIKTMLEDC-------------------------------GM 36
            ::.|.|.:.|.|..|.:||:.|..:|..|.|.                               ..
Yeast     5 NVVLVSGEGERFTVDKKIAERSLLLKNYLNDMHDSNLQNNSDSESDSDSETNHKSKDNNNGDDDD 69

  Fly    37 EDDENAIVPLPNVNSTILRKVLTWAHYHKDDPQPTEDDESKEKRTDDIISWDADFLKVDQGTLFE 101
            |||:..::|:|||.|::|:||:.||.:|:|...|.|||:...| :..:.|||.:||||||..|:|
Yeast    70 EDDDEIVMPVPNVRSSVLQKVIEWAEHHRDSNFPDEDDDDSRK-SAPVDSWDREFLKVDQEMLYE 133

  Fly   102 LILAANYLDIKGLLELTCKTVANMIKGKTPEEIRKTFNIKKDFSPAEEEQVRKENEWCEEK 162
            :|||||||:||.||:..||.||.||:|::|||||:||||..||:|.||..:|:||||.|::
Yeast   134 IILAANYLNIKPLLDAGCKVVAEMIRGRSPEEIRRTFNIVNDFTPEEEAAIRRENEWAEDR 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpANP_001033818.1 BTB_POZ_SKP1 4..126 CDD:349631 57/152 (38%)
Skp1 112..159 CDD:396171 28/46 (61%)
SKP1NP_010615.3 SKP1 3..194 CDD:227528 80/189 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344324
Domainoid 1 1.000 67 1.000 Domainoid score I2347
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38775
Inparanoid 1 1.050 154 1.000 Inparanoid score I1094
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 1 1.000 - - otm46619
orthoMCL 1 0.900 - - OOG6_100934
Panther 1 1.100 - - LDO PTHR11165
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1343
SonicParanoid 1 1.000 - - X346
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.