DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpA and SK18

DIOPT Version :9

Sequence 1:NP_001033818.1 Gene:SkpA / 31016 FlyBaseID:FBgn0025637 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_563864.2 Gene:SK18 / 837562 AraportID:AT1G10230 Length:158 Species:Arabidopsis thaliana


Alignment Length:157 Identity:73/157 - (46%)
Similarity:101/157 - (64%) Gaps:10/157 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKLQSSDEEIFDTDIQIAKCSGTIKTMLED-CGMEDDENAIVPLPNVNSTILRKVLTWAHYHKDD 67
            |.|.|||.|.|:.|..:|:....|..|:|| |..|     .:||.||...||.|::.:|..|.::
plant     6 ILLTSSDGESFEIDEAVARKFLIIVHMMEDNCAGE-----AIPLENVTGDILSKIIEYAKMHVNE 65

  Fly    68 PQPTEDDESKEKRTDDIISWDADFL-KVDQGTLFELILAANYLDIKGLLELTCKTVANMIKGKTP 131
            |...::||..:|..|   ||||.|: |:|..|:|::|||||||:.:|||....:|||:.||.|||
plant    66 PSEEDEDEEAKKNLD---SWDAKFMEKLDLETIFKIILAANYLNFEGLLGFASQTVADYIKDKTP 127

  Fly   132 EEIRKTFNIKKDFSPAEEEQVRKENEW 158
            ||:|:.|||:.||:|.|||::||||.|
plant   128 EEVREIFNIENDFTPEEEEEIRKENAW 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpANP_001033818.1 BTB_POZ_SKP1 4..126 CDD:349631 51/123 (41%)
Skp1 112..159 CDD:396171 28/47 (60%)
SK18NP_563864.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X346
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.890

Return to query results.
Submit another query.