DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpA and SK12

DIOPT Version :9

Sequence 1:NP_001033818.1 Gene:SkpA / 31016 FlyBaseID:FBgn0025637 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_567967.1 Gene:SK12 / 829598 AraportID:AT4G34470 Length:152 Species:Arabidopsis thaliana


Alignment Length:159 Identity:80/159 - (50%)
Similarity:104/159 - (65%) Gaps:13/159 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKLQSSDEEIFDTDIQIAKCSGTIKTMLEDCGMEDDENAIVPLPNVNSTILRKVLTWA-HYHKDD 67
            |.|.|||.:.|:.:..:|..|.||..|:||..:.|.    :||.||.|.||.||:.:. .||.|:
plant     6 IVLMSSDGQSFEVEEAVAIQSQTIAHMVEDDCVADG----IPLANVESKILVKVIEYCKKYHVDE 66

  Fly    68 PQPTEDDESKEKRTDDIISWDADFLKVDQGTLFELILAANYLDIKGLLELTCKTVANMIKGKTPE 132
            ..|..:        :|:..||..|:.::|.|:||||||||||:||.|.:|||:|||:||||||||
plant    67 ANPISE--------EDLNKWDEKFMDLEQSTIFELILAANYLNIKSLFDLTCQTVADMIKGKTPE 123

  Fly   133 EIRKTFNIKKDFSPAEEEQVRKENEWCEE 161
            |||.||||:.||:|.|||.|||||:|..|
plant   124 EIRSTFNIENDFTPEEEEAVRKENQWAFE 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpANP_001033818.1 BTB_POZ_SKP1 4..126 CDD:349631 52/122 (43%)
Skp1 112..159 CDD:396171 34/46 (74%)
SK12NP_567967.1 Skp1 3..102 CDD:214704 43/107 (40%)
SKP1 5..150 CDD:227528 78/155 (50%)
Skp1 77..150 CDD:279768 50/72 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 86 1.000 Domainoid score I2782
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1572
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 1 1.000 - - mtm992
orthoMCL 1 0.900 - - OOG6_100934
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X346
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.