DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpA and SK21

DIOPT Version :9

Sequence 1:NP_001033818.1 Gene:SkpA / 31016 FlyBaseID:FBgn0025637 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_567113.1 Gene:SK21 / 825314 AraportID:AT3G61415 Length:351 Species:Arabidopsis thaliana


Alignment Length:150 Identity:44/150 - (29%)
Similarity:80/150 - (53%) Gaps:13/150 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKLQSSDEEIFDTDIQIAKCSGTIKTMLEDCGMEDDENAIVPLP-NVNSTILRKVLTWAHYHKDD 67
            |.|:::|..|...:.::|.....|...:...|:...:|..:.|| .||..:|..:..:..:|:  
plant    18 IWLETADGSIQQVEQEVAMFCPMICQEVIQKGVGSSKNYAISLPQRVNPAMLSLIFDYCRFHQ-- 80

  Fly    68 PQPTEDDESKEKRTDDIISWDADFLKVDQGTLFELILAANYLDIKGLLELTCKTVANMIKGKTPE 132
               .....:||::.     :|..|:::|...|.||..||:.|.:|.|::||.:.:|.:|:|||||
plant    81 ---VPGRSNKERKV-----YDEKFIRMDTKRLCELTSAADSLQLKPLVDLTSRALARIIEGKTPE 137

  Fly   133 EIRKTFNIKKDFSPAEEEQV 152
            |||:.|::..|.:  |||::
plant   138 EIREIFHLPDDLT--EEEKL 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpANP_001033818.1 BTB_POZ_SKP1 4..126 CDD:349631 30/122 (25%)
Skp1 112..159 CDD:396171 19/40 (48%)
SK21NP_567113.1 Skp1 15..116 CDD:214704 25/107 (23%)
Skp1 90..153 CDD:279768 26/69 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.