DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpA and SK13

DIOPT Version :9

Sequence 1:NP_001033818.1 Gene:SkpA / 31016 FlyBaseID:FBgn0025637 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_567090.1 Gene:SK13 / 825171 AraportID:AT3G60010 Length:154 Species:Arabidopsis thaliana


Alignment Length:160 Identity:73/160 - (45%)
Similarity:99/160 - (61%) Gaps:12/160 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKLQSSDEEIFDTDIQIAKCSGTIKTMLEDCGMEDDENAIVPLPNVNSTILRKVLTWAHYHKDDP 68
            :.|.|||.|.|..:..:|..|.||..|:||..:.:.    ||:.||...||.||:.:...|....
plant     5 VMLLSSDGESFQVEEAVAVQSQTIAHMIEDDCVANG----VPIANVTGVILSKVIEYCKKHVVSD 65

  Fly    69 QPTEDDESKEKRTDDIISWDADFLKV--DQGTLFELILAANYLDIKGLLELTCKTVANMIKGKTP 131
            .|||  |||    |::..|||:|:|.  ...|||:::||||||:||.||:|.|:|||:||.||.|
plant    66 SPTE--ESK----DELKKWDAEFMKALEQSSTLFDVMLAANYLNIKDLLDLGCQTVADMITGKKP 124

  Fly   132 EEIRKTFNIKKDFSPAEEEQVRKENEWCEE 161
            :|||....|:.||:|.|||::||||:|..|
plant   125 DEIRALLGIENDFTPEEEEEIRKENQWAFE 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpANP_001033818.1 BTB_POZ_SKP1 4..126 CDD:349631 52/123 (42%)
Skp1 112..159 CDD:396171 27/46 (59%)
SK13NP_567090.1 BTB_POZ_SKP1 4..119 CDD:349631 52/123 (42%)
Skp1 105..152 CDD:396171 27/46 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1572
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 1 1.000 - - mtm992
orthoMCL 1 0.900 - - OOG6_100934
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X346
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.