DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpA and SK6

DIOPT Version :10

Sequence 1:NP_477390.1 Gene:SkpA / 31016 FlyBaseID:FBgn0025637 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_566978.1 Gene:SK6 / 824472 AraportID:AT3G53060 Length:85 Species:Arabidopsis thaliana


Alignment Length:94 Identity:41/94 - (43%)
Similarity:57/94 - (60%) Gaps:18/94 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IKTMLE-DCGMEDDENAIVPLPNVNSTILRKVLTWAHYHKDDPQPTEDDESKEKRTDDIISWDAD 90
            ||.|.| ||.    :|.| |||||.|.||..|:.:...|.        .||||   :|:..|||:
plant     3 IKGMAEDDCA----DNGI-PLPNVTSKILLLVIEYCKKHV--------VESKE---EDLKKWDAE 51

  Fly    91 FL-KVDQGTLFELILAANYLDIKGLLELT 118
            |: |::|..||::::|||||:|:.||:||
plant    52 FMKKMEQSILFDVMMAANYLNIQSLLDLT 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpANP_477390.1 BTB_POZ_SKP1 4..126 CDD:349631 41/94 (44%)
Skp1 112..159 CDD:460222 4/7 (57%)
SK6NP_566978.1 BTB_POZ 2..80 CDD:453885 39/92 (42%)

Return to query results.
Submit another query.