DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpA and SK10

DIOPT Version :9

Sequence 1:NP_001033818.1 Gene:SkpA / 31016 FlyBaseID:FBgn0025637 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_566695.1 Gene:SK10 / 821740 AraportID:AT3G21860 Length:152 Species:Arabidopsis thaliana


Alignment Length:156 Identity:67/156 - (42%)
Similarity:95/156 - (60%) Gaps:13/156 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKLQSSDEEIFDTDIQIAKCSGTIKTMLEDCGMEDDENAIVPLPNVNSTILRKVLTWAH-YHKDD 67
            |.|:|||...|:.:.:.|....||..|.||   :..:|.| |||.|...||..|:.:.: :|.|.
plant     6 IILKSSDGHSFEVEEEAACQCQTIAHMSED---DCTDNGI-PLPEVTGKILEMVIEYCNKHHVDA 66

  Fly    68 PQPTEDDESKEKRTDDIISWDADFLKVDQGTLFELILAANYLDIKGLLELTCKTVANMIKGKTPE 132
            ..|..|::.|:        ||.:|::..|.|:|:||:|||||:||.||:|.|:|||:|||..|.|
plant    67 ANPCSDEDLKK--------WDKEFMEKYQSTIFDLIMAANYLNIKSLLDLACQTVADMIKDNTVE 123

  Fly   133 EIRKTFNIKKDFSPAEEEQVRKENEW 158
            ..||.|||:.|::..|||.||:||:|
plant   124 HTRKFFNIENDYTHEEEEAVRRENQW 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpANP_001033818.1 BTB_POZ_SKP1 4..126 CDD:349631 48/122 (39%)
Skp1 112..159 CDD:396171 27/47 (57%)
SK10NP_566695.1 SKP1 3..149 CDD:227528 66/154 (43%)
Skp1 4..102 CDD:214704 39/107 (36%)
Skp1 76..149 CDD:279768 41/80 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1572
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 1 1.000 - - mtm992
orthoMCL 1 0.900 - - OOG6_100934
Panther 1 1.100 - - O PTHR11165
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X346
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.930

Return to query results.
Submit another query.