DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpA and SK9

DIOPT Version :9

Sequence 1:NP_001033818.1 Gene:SkpA / 31016 FlyBaseID:FBgn0025637 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_566694.1 Gene:SK9 / 821739 AraportID:AT3G21850 Length:153 Species:Arabidopsis thaliana


Alignment Length:161 Identity:70/161 - (43%)
Similarity:98/161 - (60%) Gaps:16/161 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKLQSSDEEIFDTDIQIAK-CSGTIKTMLE-DCGMEDDENAIVPLPNVNSTILRKVLTWAH-YHK 65
            |.|:|||...|:.:.:.|: |...|..|.| ||    .:|.| |||||...||..|:.:.: :|.
plant     6 IILKSSDGHSFEVEEEAARQCQIIIAHMSENDC----TDNGI-PLPNVTGKILAMVIEYCNKHHV 65

  Fly    66 DDPQPTEDDESKEKRTDDIISWDADFLKVDQGTLFELILAANYLDIKGLLELTCKTVANMIKGKT 130
            |...|..||:.|:        ||.:|::.|..|:|:||.|||||:||.|.:|.|:|||.:|||.|
plant    66 DAANPCSDDDLKK--------WDKEFMEKDTSTIFDLIKAANYLNIKSLFDLACQTVAEIIKGNT 122

  Fly   131 PEEIRKTFNIKKDFSPAEEEQVRKENEWCEE 161
            ||:||:.|||:.|.:|.||..:|:||:|..|
plant   123 PEQIREFFNIENDLTPEEEAAIRRENKWAFE 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpANP_001033818.1 BTB_POZ_SKP1 4..126 CDD:349631 50/124 (40%)
Skp1 112..159 CDD:396171 25/46 (54%)
SK9NP_566694.1 BTB_POZ_SKP1 5..118 CDD:349631 50/124 (40%)
Skp1 104..151 CDD:366656 25/46 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1572
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 1 1.000 - - mtm992
orthoMCL 1 0.900 - - OOG6_100934
Panther 1 1.100 - - O PTHR11165
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X346
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.930

Return to query results.
Submit another query.