DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpA and SK8

DIOPT Version :9

Sequence 1:NP_001033818.1 Gene:SkpA / 31016 FlyBaseID:FBgn0025637 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_566692.1 Gene:SK8 / 821737 AraportID:AT3G21830 Length:152 Species:Arabidopsis thaliana


Alignment Length:159 Identity:61/159 - (38%)
Similarity:95/159 - (59%) Gaps:13/159 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKLQSSDEEIFDTDIQIAKCSGTIKTMLEDCGMEDDENAIVPLPNVNSTILRKVLTWAH-YHKDD 67
            |.|:||:.:.|:.:.:.|:...||..|:|   .|..:|.|:.| .:.|.||..|:.:.: :|.|.
plant     6 IMLKSSEGKTFEIEEETARQCQTIAHMIE---AECTDNVILVL-KMTSEILEMVIEYCNKHHVDA 66

  Fly    68 PQPTEDDESKEKRTDDIISWDADFLKVDQGTLFELILAANYLDIKGLLELTCKTVANMIKGKTPE 132
            ..|..|        ||:..||.:|::.|:.|:|.|..|||:|:.|.||.|..:|||:||||.||:
plant    67 ANPCSD--------DDLEKWDKEFMEKDKSTIFALTNAANFLNNKSLLHLAGQTVADMIKGNTPK 123

  Fly   133 EIRKTFNIKKDFSPAEEEQVRKENEWCEE 161
            ::|:.|||:.|.:|.||..:|:||:|..|
plant   124 QMREFFNIENDLTPEEEAAIRRENKWAFE 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpANP_001033818.1 BTB_POZ_SKP1 4..126 CDD:349631 42/122 (34%)
Skp1 112..159 CDD:396171 24/46 (52%)
SK8NP_566692.1 SKP1 3..150 CDD:227528 59/155 (38%)
Skp1 4..101 CDD:214704 34/106 (32%)
Skp1 77..150 CDD:279768 35/72 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 1 1.000 - - mtm992
orthoMCL 1 0.900 - - OOG6_100934
Panther 1 1.100 - - O PTHR11165
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X346
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.880

Return to query results.
Submit another query.