DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpA and SK3

DIOPT Version :9

Sequence 1:NP_001033818.1 Gene:SkpA / 31016 FlyBaseID:FBgn0025637 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_565604.1 Gene:SK3 / 817111 AraportID:AT2G25700 Length:163 Species:Arabidopsis thaliana


Alignment Length:168 Identity:76/168 - (45%)
Similarity:103/168 - (61%) Gaps:22/168 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKLQSSDEEIFDTDIQIAKCSGTIKTMLEDCGMEDDENAIVPLPNVNSTILRKVLTWAHYH---- 64
            |.|:|||.|.|:.:..:|..|.|||.|:||..:::.    :|||||...||.||:.:...|    
plant     8 IILKSSDGESFEVEEAVAVESQTIKHMIEDDCVDNG----IPLPNVTGAILAKVIEYCKKHVEAA 68

  Fly    65 ------KDDPQPTEDDESKEKRTDDIISWDADFLKVDQGTLFELILAANYLDIKGLLELTCKTVA 123
                  ||....||:.|.|        :||.||:|||..|||:|:.|||||:|.|||:||||.||
plant    69 AEAGGDKDFYGSTENHELK--------TWDNDFVKVDHPTLFDLLRAANYLNISGLLDLTCKAVA 125

  Fly   124 NMIKGKTPEEIRKTFNIKKDFSPAEEEQVRKENEWCEE 161
            :.::||||.::|:.||||.|::|.||.:||.||.|..|
plant   126 DQMRGKTPAQMREHFNIKNDYTPEEEAEVRNENRWAFE 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpANP_001033818.1 BTB_POZ_SKP1 4..126 CDD:349631 57/131 (44%)
Skp1 112..159 CDD:396171 26/46 (57%)
SK3NP_565604.1 BTB_POZ_SKP1 7..128 CDD:349631 57/131 (44%)
Skp1 115..161 CDD:396171 26/45 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1572
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 1 1.000 - - mtm992
orthoMCL 1 0.900 - - OOG6_100934
Panther 1 1.100 - - O PTHR11165
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X346
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.930

Return to query results.
Submit another query.