DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpA and MEO

DIOPT Version :9

Sequence 1:NP_001033818.1 Gene:SkpA / 31016 FlyBaseID:FBgn0025637 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_565467.1 Gene:MEO / 816536 AraportID:AT2G20160 Length:150 Species:Arabidopsis thaliana


Alignment Length:156 Identity:58/156 - (37%)
Similarity:92/156 - (58%) Gaps:15/156 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKLQSSDEEIFDTDIQIAKCSGTIKTMLEDCGMEDDENAIVPLPNVNSTILRKVLTWAHYHKDDP 68
            |.|.|||:|.|:.|..:|:....:..|::|    |..:..:.|.||...||..::.:...|.||.
plant     6 IVLTSSDDECFEIDEAVARKMQMVAHMIDD----DCADKAIRLQNVTGKILAIIIEYCKKHVDDV 66

  Fly    69 QPTEDDESKEKRTDDIISWDADFLK-VDQGTLFELILAANYLDIKGLLELTCKTVANMIKGKTPE 132
                  |:|    ::.::|||:|:| :|..|||:|:.||:||.:.||..|..:.:|:....||..
plant    67 ------EAK----NEFVTWDAEFVKNIDMDTLFKLLDAADYLIVIGLKNLIAQAIADYTADKTVN 121

  Fly   133 EIRKTFNIKKDFSPAEEEQVRKENEW 158
            |||:.|||:.|::|.|||::||:|||
plant   122 EIRELFNIENDYTPEEEEELRKKNEW 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpANP_001033818.1 BTB_POZ_SKP1 4..126 CDD:349631 40/122 (33%)
Skp1 112..159 CDD:396171 22/47 (47%)
MEONP_565467.1 BTB_POZ_SKP1 5..114 CDD:349631 40/121 (33%)
Skp1 102..148 CDD:396171 22/46 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.890

Return to query results.
Submit another query.