DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpA and SK14

DIOPT Version :9

Sequence 1:NP_001033818.1 Gene:SkpA / 31016 FlyBaseID:FBgn0025637 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_565296.1 Gene:SK14 / 814846 AraportID:AT2G03170 Length:149 Species:Arabidopsis thaliana


Alignment Length:160 Identity:74/160 - (46%)
Similarity:100/160 - (62%) Gaps:18/160 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKLQSSDEEIFDTDIQIAKCSGTIKTMLE-DCGMEDDENAIVPLPNVNSTILRKVLTWAHYHKDD 67
            |.|.|||.|.|:.:..:|:....::.|:| ||.:.:     |||.||...||..|:.:...|   
plant     6 IVLSSSDGESFEVEEAVARKLKIVEHMIEDDCVVTE-----VPLQNVTGKILSIVVEYCKKH--- 62

  Fly    68 PQPTEDDESKEKRTDDIISWDADFL-KVDQGTLFELILAANYLDIKGLLELTCKTVANMIKGKTP 131
               ..|:||.|.:|     ||.:|: |.||.|:|:|:||||||:|||||:|:.:|||:.||.|||
plant    63 ---VVDEESDEFKT-----WDEEFMKKFDQPTVFQLLLAANYLNIKGLLDLSAQTVADRIKDKTP 119

  Fly   132 EEIRKTFNIKKDFSPAEEEQVRKENEWCEE 161
            ||||:.|||:.||:|.||..|||||.|..|
plant   120 EEIREIFNIENDFTPEEEAAVRKENAWAFE 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpANP_001033818.1 BTB_POZ_SKP1 4..126 CDD:349631 50/123 (41%)
Skp1 112..159 CDD:396171 30/46 (65%)
SK14NP_565296.1 SKP1 3..147 CDD:227528 72/156 (46%)
Skp1 3..99 CDD:214704 41/108 (38%)
Skp1 72..147 CDD:279768 47/79 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1572
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 1 1.000 - - mtm992
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X346
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.940

Return to query results.
Submit another query.