DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpA and SK19

DIOPT Version :9

Sequence 1:NP_001033818.1 Gene:SkpA / 31016 FlyBaseID:FBgn0025637 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_565295.1 Gene:SK19 / 814845 AraportID:AT2G03160 Length:200 Species:Arabidopsis thaliana


Alignment Length:190 Identity:68/190 - (35%)
Similarity:100/190 - (52%) Gaps:35/190 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKLQSSDEEIFDTDIQIAKCSGTIKTMLEDCGMEDDENAIVPLPNVNSTILRKVLTWAHYHKDD- 67
            |.|.|||.|.|..:..:|:....:..::||    |.....:|:|||...||.||:.:...|.:| 
plant     6 IVLTSSDGESFKVEEVVARKLQIVGHIIED----DCATNKIPIPNVTGEILAKVIEYCKKHVEDD 66

  Fly    68 -----------------------------PQPTEDDESKEKRTDDIISWDADFLK-VDQGTLFEL 102
                                         |:.||.|:..|.:.:.:..|||.|:| .|..|:|::
plant    67 DDVVETHESSTKGDKTVEEAKKKPDDVAVPESTEGDDEAEDKKEKLNEWDAKFMKDFDIKTIFDI 131

  Fly   103 ILAANYLDIKGLLELTCKTVANMIKGKTPEEIRKTFNIKKDFSPAEEEQVRKENEWCEEK 162
            |||||||:::||.:|..||:|:.||..||||:|:.|||:.||:|.|||.:|.||.|..|:
plant   132 ILAANYLNVQGLFDLCSKTIADYIKDMTPEEVRELFNIENDFTPEEEEAIRNENAWTFEQ 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpANP_001033818.1 BTB_POZ_SKP1 4..126 CDD:349631 47/152 (31%)
Skp1 112..159 CDD:396171 25/46 (54%)
SK19NP_565295.1 Skp1 3..140 CDD:214704 41/137 (30%)
SKP1 5..187 CDD:227528 66/184 (36%)
Skp1 114..187 CDD:279768 40/72 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1572
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 1 1.000 - - mtm992
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X346
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.940

Return to query results.
Submit another query.