DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpA and skp1

DIOPT Version :9

Sequence 1:NP_001033818.1 Gene:SkpA / 31016 FlyBaseID:FBgn0025637 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_001016519.1 Gene:skp1 / 549273 XenbaseID:XB-GENE-919631 Length:163 Species:Xenopus tropicalis


Alignment Length:163 Identity:125/163 - (76%)
Similarity:142/163 - (87%) Gaps:1/163 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPSIKLQSSDEEIFDTDIQIAKCSGTIKTMLEDCGMEDD-ENAIVPLPNVNSTILRKVLTWAHYH 64
            ||||||||||.|||:.|::|||.|.||||||||.||:|: ::..|||||||:.||:||:.|..:|
 Frog     1 MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHH 65

  Fly    65 KDDPQPTEDDESKEKRTDDIISWDADFLKVDQGTLFELILAANYLDIKGLLELTCKTVANMIKGK 129
            ||||.|.||||:||||||||..||.:|||||||||||||||||||||||||::||||||||||||
 Frog    66 KDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGK 130

  Fly   130 TPEEIRKTFNIKKDFSPAEEEQVRKENEWCEEK 162
            ||||||||||||.||:..||.||||||:|||||
 Frog   131 TPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpANP_001033818.1 BTB_POZ_SKP1 4..126 CDD:349631 90/122 (74%)
Skp1 112..159 CDD:396171 38/46 (83%)
skp1NP_001016519.1 BTB_POZ_SKP1 4..127 CDD:349631 90/122 (74%)
Skp1 113..160 CDD:396171 38/46 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 89 1.000 Domainoid score I7764
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H38775
Inparanoid 1 1.050 255 1.000 Inparanoid score I3096
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 1 1.000 - - otm48533
Panther 1 1.100 - - LDO PTHR11165
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1343
SonicParanoid 1 1.000 - - X346
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.190

Return to query results.
Submit another query.