DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpA and skp1

DIOPT Version :9

Sequence 1:NP_001033818.1 Gene:SkpA / 31016 FlyBaseID:FBgn0025637 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_957037.1 Gene:skp1 / 393716 ZFINID:ZDB-GENE-040426-1707 Length:163 Species:Danio rerio


Alignment Length:163 Identity:123/163 - (75%)
Similarity:142/163 - (87%) Gaps:1/163 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPSIKLQSSDEEIFDTDIQIAKCSGTIKTMLEDCGMEDD-ENAIVPLPNVNSTILRKVLTWAHYH 64
            ||:|||||||.|:|:.|::|||.|.||||||||.||:|: ::..|||||||:.||:||:.|..:|
Zfish     1 MPTIKLQSSDGEMFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHH 65

  Fly    65 KDDPQPTEDDESKEKRTDDIISWDADFLKVDQGTLFELILAANYLDIKGLLELTCKTVANMIKGK 129
            ||||.|.||||:||||||||..||.:|||||||||||||||||||||||||::||||||||||||
Zfish    66 KDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGK 130

  Fly   130 TPEEIRKTFNIKKDFSPAEEEQVRKENEWCEEK 162
            ||||||||||||.||:..||.||||||:|||||
Zfish   131 TPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpANP_001033818.1 BTB_POZ_SKP1 4..126 CDD:349631 89/122 (73%)
Skp1 112..159 CDD:396171 38/46 (83%)
skp1NP_957037.1 BTB_POZ_SKP1 3..127 CDD:349631 89/123 (72%)
Skp1 113..160 CDD:396171 38/46 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583352
Domainoid 1 1.000 89 1.000 Domainoid score I7883
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38775
Inparanoid 1 1.050 253 1.000 Inparanoid score I3187
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 1 1.000 - - otm25944
orthoMCL 1 0.900 - - OOG6_100934
Panther 1 1.100 - - LDO PTHR11165
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1343
SonicParanoid 1 1.000 - - X346
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.