DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpA and SkpB

DIOPT Version :9

Sequence 1:NP_001033818.1 Gene:SkpA / 31016 FlyBaseID:FBgn0025637 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_610729.1 Gene:SkpB / 36298 FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster


Alignment Length:162 Identity:119/162 - (73%)
Similarity:140/162 - (86%) Gaps:1/162 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPSIKLQSSDEEIFDTDIQIAKCSGTIKTMLEDCGMEDDENAIVPLPNVNSTILRKVLTWAHYHK 65
            ||.|:|:|:|:||||||.:|||||.||:..:||.|.|.| |:::|||||||.||:|||.||.|||
  Fly     1 MPIIRLESADKEIFDTDQEIAKCSETIRIAIEDLGDESD-NSVLPLPNVNSLILKKVLHWATYHK 64

  Fly    66 DDPQPTEDDESKEKRTDDIISWDADFLKVDQGTLFELILAANYLDIKGLLELTCKTVANMIKGKT 130
            |||..||:.|:||||||||.||||||||||||||||||||||||:|:|||::||||||||||||:
  Fly    65 DDPVVTEEVENKEKRTDDISSWDADFLKVDQGTLFELILAANYLNIQGLLDVTCKTVANMIKGKS 129

  Fly   131 PEEIRKTFNIKKDFSPAEEEQVRKENEWCEEK 162
            |:.||.||.|:.||.|.|||||||||||||:|
  Fly   130 PQAIRDTFAIQNDFLPQEEEQVRKENEWCEDK 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpANP_001033818.1 BTB_POZ_SKP1 4..126 CDD:349631 89/121 (74%)
Skp1 112..159 CDD:396171 34/46 (74%)
SkpBNP_610729.1 SKP1 1..161 CDD:227528 118/160 (74%)
Skp1 1..110 CDD:214704 80/109 (73%)
Skp1 84..158 CDD:279768 59/73 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452344
Domainoid 1 1.000 60 1.000 Domainoid score I3858
eggNOG 1 0.900 - - E1_COG5201
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1572
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 1 1.000 - - otm25944
orthoMCL 1 0.900 - - OOG6_100934
Panther 1 1.100 - - P PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X346
1110.800

Return to query results.
Submit another query.