DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpA and SkpE

DIOPT Version :9

Sequence 1:NP_001033818.1 Gene:SkpA / 31016 FlyBaseID:FBgn0025637 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_608359.1 Gene:SkpE / 32997 FlyBaseID:FBgn0031074 Length:167 Species:Drosophila melanogaster


Alignment Length:153 Identity:84/153 - (54%)
Similarity:111/153 - (72%) Gaps:1/153 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PSIKLQSSDEEIFDTDIQIAKCSGTIKTMLEDCGMEDDENAIVPLPNVNSTILRKVLTWAHYHK- 65
            |:|||:||:..||.|::::|..|.||||||:...:::||||||||.:|::..|.|:|.||::|| 
  Fly     4 PTIKLESSEGVIFPTEVRVAMVSETIKTMLDHFAVQNDENAIVPLHSVSTFTLGKILAWANHHKD 68

  Fly    66 DDPQPTEDDESKEKRTDDIISWDADFLKVDQGTLFELILAANYLDIKGLLELTCKTVANMIKGKT 130
            ||.|.||.:|.|.:|...|..|||.||.|:..||.|:||||..|.||||||||...|||||:|||
  Fly    69 DDDQSTEGEELKPRRPYAISPWDAIFLMVNSTTLLEIILAAKQLQIKGLLELTYNVVANMIRGKT 133

  Fly   131 PEEIRKTFNIKKDFSPAEEEQVR 153
            |||||..|||.:|.||:.:.::|
  Fly   134 PEEIRFIFNIPEDVSPSVDGELR 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpANP_001033818.1 BTB_POZ_SKP1 4..126 CDD:349631 66/122 (54%)
Skp1 112..159 CDD:396171 27/42 (64%)
SkpENP_608359.1 SKP1 3..156 CDD:227528 83/151 (55%)
BTB 6..114 CDD:295341 55/107 (51%)
Skp1 88..156 CDD:279768 41/67 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452336
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.