DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpA and SkpC

DIOPT Version :9

Sequence 1:NP_001033818.1 Gene:SkpA / 31016 FlyBaseID:FBgn0025637 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_608358.1 Gene:SkpC / 32996 FlyBaseID:FBgn0026175 Length:158 Species:Drosophila melanogaster


Alignment Length:155 Identity:92/155 - (59%)
Similarity:116/155 - (74%) Gaps:2/155 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PSIKLQSSDEEIFDTDIQIAKCSGTIKTMLEDCGMEDDENAIVPLPNVNSTILRKVLTWAHYHK- 65
            |:|||:|||..||.|:::.||.|.|||||||...:|:|||||||||.||:.||.|:|||.::|| 
  Fly     4 PTIKLESSDGMIFSTEVRAAKLSETIKTMLEVSAVENDENAIVPLPKVNAFILSKILTWIYHHKD 68

  Fly    66 DDPQPTEDDESKEKRTDDIISWDADFLKVDQGTLFELILAANYLDIKGLLELTCKTVANMIKGKT 130
            ||....|..|...:...||.:|||:|:.|||.||||:|||||||:||||::|.||||||||:|||
  Fly    69 DDAHGAEGVELSPQSPHDISAWDANFINVDQPTLFEIILAANYLEIKGLVDLCCKTVANMIRGKT 133

  Fly   131 PEEIRKTFNIKKDFSPAEEEQVRKE 155
            |||||.|||| .|..|:...|:.::
  Fly   134 PEEIRHTFNI-PDEIPSRTAQLGED 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpANP_001033818.1 BTB_POZ_SKP1 4..126 CDD:349631 74/122 (61%)
Skp1 112..159 CDD:396171 27/44 (61%)
SkpCNP_608358.1 Skp1 6..114 CDD:214704 63/107 (59%)
Skp1 88..>146 CDD:279768 43/58 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452337
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1572
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 1 1.000 - - otm46619
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X346
109.900

Return to query results.
Submit another query.