DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpA and skp1

DIOPT Version :9

Sequence 1:NP_001033818.1 Gene:SkpA / 31016 FlyBaseID:FBgn0025637 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_595455.1 Gene:skp1 / 2540917 PomBaseID:SPBC409.05 Length:161 Species:Schizosaccharomyces pombe


Alignment Length:164 Identity:93/164 - (56%)
Similarity:117/164 - (71%) Gaps:5/164 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPSIKLQSSDEEIFDTDIQIAKCSGTIKTMLEDCGMEDDENAIVPLPNVNSTILRKVLTWAHYHK 65
            |..|||.|||.|.|..|..||:.|..||.||||.|   :.|..:|||||:|.:|||||.|..:||
pombe     1 MSKIKLISSDNEEFVVDQLIAERSMLIKNMLEDVG---EINVPIPLPNVSSNVLRKVLEWCEHHK 62

  Fly    66 DDPQPTEDDES--KEKRTDDIISWDADFLKVDQGTLFELILAANYLDIKGLLELTCKTVANMIKG 128
            :|.....::||  :.|::.||..||..|:.|||..|||::||:||||||.||:..||||||||:|
pombe    63 NDLYSGTEEESDIRLKKSTDIDEWDRKFMAVDQEMLFEIVLASNYLDIKPLLDTGCKTVANMIRG 127

  Fly   129 KTPEEIRKTFNIKKDFSPAEEEQVRKENEWCEEK 162
            |:||:|||||||..||:|.||||:||||||.|::
pombe   128 KSPEDIRKTFNIPNDFTPEEEEQIRKENEWAEDR 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpANP_001033818.1 BTB_POZ_SKP1 4..126 CDD:349631 65/123 (53%)
Skp1 112..159 CDD:396171 34/46 (74%)
skp1NP_595455.1 SKP1 1..161 CDD:227528 93/162 (57%)
Skp1 1..110 CDD:214704 55/111 (50%)
Skp1 84..158 CDD:279768 50/73 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 79 1.000 Domainoid score I2355
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38775
Inparanoid 1 1.050 179 1.000 Inparanoid score I1131
OMA 1 1.010 - - QHG54148
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 1 1.000 - - otm47251
orthoMCL 1 0.900 - - OOG6_100934
Panther 1 1.100 - - LDO PTHR11165
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1343
SonicParanoid 1 1.000 - - X346
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.