DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpA and skr-16

DIOPT Version :9

Sequence 1:NP_001033818.1 Gene:SkpA / 31016 FlyBaseID:FBgn0025637 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_501128.2 Gene:skr-16 / 191765 WormBaseID:WBGene00004822 Length:181 Species:Caenorhabditis elegans


Alignment Length:166 Identity:52/166 - (31%)
Similarity:73/166 - (43%) Gaps:38/166 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LQSSDEEIFDTDIQIAKCSGTIKTMLEDCGMEDDENAIVPLPNVNSTILRKVLTWAHYHKDD--- 67
            |.|||.|.|.||   ..|....|.:::.....:..:..:.:..|....|.:||.|.:.|:||   
 Worm    34 LISSDGEKFQTD---GHCIRHSKVLMQASKSLETPDTPIQVEKVQGDTLNRVLEWCNNHRDDGKY 95

  Fly    68 ----------PQPTEDDESKEKRTDDIISWDADFLK-VDQGTLFELILAANYLDIKGLLELTCKT 121
                      ||                 ||..:|| :|...|.:||.|:|.|.::.|::..|||
 Worm    96 VSQCGPSLRLPQ-----------------WDFRWLKDLDNQELVDLINASNDLQMQQLMDYACKT 143

  Fly   122 VANMIKGKTPEEIRKTFNIKKDFSPAEEEQVRKENE 157
            ||||.|||.|.::|:.|.|..|    |||.....||
 Worm   144 VANMAKGKNPAQLRELFGILTD----EEEAELALNE 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpANP_001033818.1 BTB_POZ_SKP1 4..126 CDD:349631 38/133 (29%)
Skp1 112..159 CDD:396171 21/46 (46%)
skr-16NP_501128.2 Skp1 30..133 CDD:214704 31/118 (26%)
Skp1 106..>165 CDD:279768 28/75 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160709
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.