DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpA and skr-6

DIOPT Version :9

Sequence 1:NP_001033818.1 Gene:SkpA / 31016 FlyBaseID:FBgn0025637 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_507574.2 Gene:skr-6 / 191763 WormBaseID:WBGene00004812 Length:106 Species:Caenorhabditis elegans


Alignment Length:115 Identity:45/115 - (39%)
Similarity:70/115 - (60%) Gaps:13/115 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 VPLPNVNSTILRKVLTWAHYHKDDPQPTEDDESKEKRTDDIISWDADFLKVDQGTLFELILAANY 108
            :||..|::.|..|::.:.. |:..|:|..:.|..|        ||::|||:||.|||:|:|||||
 Worm     4 IPLTKVDAKIFEKIIEYCE-HQGTPRPLLNGEIGE--------WDSEFLKLDQNTLFDLVLAANY 59

  Fly   109 LDIKGLLELTCKTVANMIKGKTPEEIRKTFNIKKDFSPAEEEQVRKENEW 158
            |:|:.|.::|.:.:|||:|..||.:||..|.:....|.||:   |.:| |
 Worm    60 LNIENLFDVTTQFIANMMKNNTPSQIRARFGVSNKHSSAED---RSDN-W 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpANP_001033818.1 BTB_POZ_SKP1 4..126 CDD:349631 32/81 (40%)
Skp1 112..159 CDD:396171 17/47 (36%)
skr-6NP_507574.2 Skp1 <2..62 CDD:214704 27/66 (41%)
Skp1 37..>93 CDD:279768 30/63 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160701
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.810

Return to query results.
Submit another query.