DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpA and skr-4

DIOPT Version :9

Sequence 1:NP_001033818.1 Gene:SkpA / 31016 FlyBaseID:FBgn0025637 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_507857.1 Gene:skr-4 / 191762 WormBaseID:WBGene00004810 Length:159 Species:Caenorhabditis elegans


Alignment Length:159 Identity:78/159 - (49%)
Similarity:104/159 - (65%) Gaps:10/159 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKLQSSDEEIFDTDIQIAKCSGTIKTMLEDCGMEDDENAIVPLPNVNSTILRKVLTWAHYHKDD- 67
            |||.|||::.|....::...|.||.      |...::.  :|||.|.|.||.|::||..:|.|| 
 Worm    10 IKLISSDDKTFTVSRKVISQSKTIS------GFTSEDT--IPLPKVTSAILEKIITWCEHHADDE 66

  Fly    68 PQPTEDDESKEKRTDDIISWDADFLKVDQGTLFELILAANYLDIKGLLELTCKTVANMIKGKTPE 132
            |:..|..|...|:|.:|..|||:|:|||||||||:|||||||||:||||:|.:.||||:|||||.
 Worm    67 PKKVEKIEKGNKKTVEISEWDAEFMKVDQGTLFEIILAANYLDIRGLLEVTTQNVANMMKGKTPS 131

  Fly   133 EIRKTFNIKKDFSPAEEEQVRKENEWCEE 161
            ::|..|.| .:||..|.|.::|.|.|||:
 Worm   132 QVRTLFKI-DNFSEEELEAMKKGNAWCED 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpANP_001033818.1 BTB_POZ_SKP1 4..126 CDD:349631 60/122 (49%)
Skp1 112..159 CDD:396171 23/46 (50%)
skr-4NP_507857.1 Skp1 7..110 CDD:214704 50/107 (47%)
SKP1 10..159 CDD:227528 77/157 (49%)
Skp1 84..157 CDD:279768 45/73 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160708
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.820

Return to query results.
Submit another query.