DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpA and skr-7

DIOPT Version :9

Sequence 1:NP_001033818.1 Gene:SkpA / 31016 FlyBaseID:FBgn0025637 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_504221.1 Gene:skr-7 / 178840 WormBaseID:WBGene00004813 Length:194 Species:Caenorhabditis elegans


Alignment Length:160 Identity:58/160 - (36%)
Similarity:92/160 - (57%) Gaps:5/160 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KLQSSDEEIFDTDIQIAKCSGTIKTMLEDCGMEDDENAIVPLP--NVNSTILRKVLTWAHYHKDD 67
            |::|||.::::...:..|.|.|:..::..| :.:|..::.|:|  ||...|::.|:.|...||.:
 Worm    24 KVESSDGQVYEISDEAVKQSNTLSNLISTC-VANDVASMDPIPITNVTGNIMKMVIEWCEKHKGE 87

  Fly    68 PQPTEDDESKEKRTDDIISWDADFLKVDQGTLFELILAANYLDIKGLLELTCKTVANMIKGKTPE 132
            ..|.|||...:..|  :..||.:|||:|...||:||:|:|:||:.||:...||.||||..||:|:
 Worm    88 TLPVEDDSVPKNIT--VPEWDTNFLKIDNDVLFDLIVASNFLDVPGLMSYACKMVANMAIGKSPD 150

  Fly   133 EIRKTFNIKKDFSPAEEEQVRKENEWCEEK 162
            |:|..|.|..|......|:..||....|:|
 Worm   151 EMRVLFAIPTDEEDEAAEKAAKEKAEAEKK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpANP_001033818.1 BTB_POZ_SKP1 4..126 CDD:349631 44/122 (36%)
Skp1 112..159 CDD:396171 19/46 (41%)
skr-7NP_504221.1 Skp1 20..129 CDD:214704 36/107 (34%)
Skp1 103..>160 CDD:279768 29/56 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160710
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.