DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpA and skr-14

DIOPT Version :9

Sequence 1:NP_001033818.1 Gene:SkpA / 31016 FlyBaseID:FBgn0025637 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_504220.4 Gene:skr-14 / 178839 WormBaseID:WBGene00004820 Length:168 Species:Caenorhabditis elegans


Alignment Length:148 Identity:57/148 - (38%)
Similarity:82/148 - (55%) Gaps:5/148 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KLQSSDEEIFDTDIQIAKCSGTIKTMLEDCG--MEDDENA-IVPLPNVNSTILRKVLTWAHYHKD 66
            |:.|:|..:.....:..:.|.|:..::|:.|  :|:.|.. .:|:.|||...:.||..|...|..
 Worm    16 KIISNDGVVTKMSEKAVQQSKTLSNLIENLGYTIENIETRDPIPVTNVNGKTMEKVAEWCEKHNA 80

  Fly    67 DPQPTEDDESKEKRTDDIISWDADFLKVDQGTLFELILAANYLDIKGLLELTCKTVANMIKGKTP 131
            |..|  :|.....:|..|..||..|||::...||:||||:|:||||||:...||||:||.||||.
 Worm    81 DAIP--EDNMNVLKTLTIPEWDQKFLKIEDEALFDLILASNFLDIKGLMYYGCKTVSNMAKGKTT 143

  Fly   132 EEIRKTFNIKKDFSPAEE 149
            .|:|:.|.|..|...|.|
 Worm   144 AELREIFGINTDEQDAAE 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpANP_001033818.1 BTB_POZ_SKP1 4..126 CDD:349631 45/123 (37%)
Skp1 112..159 CDD:396171 20/38 (53%)
skr-14NP_504220.4 Skp1 12..123 CDD:214704 35/108 (32%)
Skp1 97..161 CDD:279768 34/63 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160700
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.