DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpA and skr-12

DIOPT Version :9

Sequence 1:NP_001033818.1 Gene:SkpA / 31016 FlyBaseID:FBgn0025637 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_001367151.1 Gene:skr-12 / 178496 WormBaseID:WBGene00004818 Length:172 Species:Caenorhabditis elegans


Alignment Length:153 Identity:60/153 - (39%)
Similarity:86/153 - (56%) Gaps:5/153 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KLQSSDEEIFDTDIQIAKCSGTIKTMLEDCG--MEDDENA-IVPLPNVNSTILRKVLTWAHYHKD 66
            |:.|||..:.....:..:.|.|:..::|:.|  :|:.|.. .:|:.|||...:.||..|...||.
 Worm    16 KIISSDGVVSKMSEKAVQQSKTLSNLIENLGYTIENIETRDPIPVTNVNGKTMAKVAEWCEKHKA 80

  Fly    67 DPQPTEDDESKEKRTDDIISWDADFLKVDQGTLFELILAANYLDIKGLLELTCKTVANMIKGKTP 131
            |..|  :|.....:|..|..||..|||::...||:||||:|:||||||:...||||:||.||||.
 Worm    81 DAIP--EDNMNVLKTLTIPEWDQKFLKIEDEALFDLILASNFLDIKGLMYFGCKTVSNMAKGKTT 143

  Fly   132 EEIRKTFNIKKDFSPAEEEQVRK 154
            .|:|:.|.|..|...|.||..::
 Worm   144 AELREIFGINTDEQDAAEETAQR 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpANP_001033818.1 BTB_POZ_SKP1 4..126 CDD:349631 47/123 (38%)
Skp1 112..159 CDD:396171 21/43 (49%)
skr-12NP_001367151.1 BTB_POZ_SKP1 14..138 CDD:349631 47/123 (38%)
Skp1 124..161 CDD:396171 19/36 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160703
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.