DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpA and skr-8

DIOPT Version :9

Sequence 1:NP_001033818.1 Gene:SkpA / 31016 FlyBaseID:FBgn0025637 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_503044.1 Gene:skr-8 / 178495 WormBaseID:WBGene00004814 Length:194 Species:Caenorhabditis elegans


Alignment Length:159 Identity:58/159 - (36%)
Similarity:88/159 - (55%) Gaps:3/159 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KLQSSDEEIFDTDIQIAKCSGTIKTMLEDCGMEDDENA-IVPLPNVNSTILRKVLTWAHYHKDDP 68
            |::|:|.::|:...:..|.|..:..::..|..||..:. .:|:.||...||:.|:.|...||.:.
 Worm    24 KVESNDGKVFEISDEAVKQSNILSNLISTCAPEDVASMDPIPITNVTGNILKMVIEWCEKHKGEA 88

  Fly    69 QPTEDDESKEKRTDDIISWDADFLKVDQGTLFELILAANYLDIKGLLELTCKTVANMIKGKTPEE 133
            .|.|||  ...:..::..||.:|||:|...||:||:|.||||:.||:...||.||||..||:|:|
 Worm    89 LPVEDD--SVPKNINVPEWDTNFLKIDNEVLFDLIVACNYLDVPGLMNYGCKMVANMAIGKSPDE 151

  Fly   134 IRKTFNIKKDFSPAEEEQVRKENEWCEEK 162
            :|..|.|..|......|:..||....|:|
 Worm   152 LRIIFAIPTDEEDEAAERAAKEKAEAEKK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpANP_001033818.1 BTB_POZ_SKP1 4..126 CDD:349631 44/121 (36%)
Skp1 112..159 CDD:396171 19/46 (41%)
skr-8NP_503044.1 Skp1 20..129 CDD:214704 36/106 (34%)
Skp1 103..>161 CDD:279768 30/57 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160696
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.