DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpA and skr-15

DIOPT Version :9

Sequence 1:NP_001033818.1 Gene:SkpA / 31016 FlyBaseID:FBgn0025637 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_494662.1 Gene:skr-15 / 173729 WormBaseID:WBGene00004821 Length:184 Species:Caenorhabditis elegans


Alignment Length:153 Identity:46/153 - (30%)
Similarity:78/153 - (50%) Gaps:7/153 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LQSSDEEIFDTDIQIAKCSGTIKTMLEDCGME-DDENAIVPLP--NVNSTILRKVLTWAHYHKDD 67
            ::|:|..:.....|..|.|.|:...:.:.|.. ::..::||:|  .||...|:.|:.|..:||.|
 Worm    23 IESNDRVVLKISEQAIKQSATLSNSITNLGYSAENAESMVPIPIEKVNGKTLKLVVEWCEHHKAD 87

  Fly    68 PQPTEDDESKEKRTDDIISWDADFLKVDQGTLFELILAANYLDIKGLLELTCKTVANMIKGKTPE 132
            |.|    |:.......:..||..|:.::...|.:|:.|:|:|::..||...||.:|.:.||.:||
 Worm    88 PVP----EAYPSGNTVLPVWDRKFVDIEHDALTDLVNASNFLEVMTLLTYCCKFIAGLAKGMSPE 148

  Fly   133 EIRKTFNIKKDFSPAEEEQVRKE 155
            |:|..|.|..|....:.|:..||
 Worm   149 EMRVFFCIPTDEEDEKAERFGKE 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpANP_001033818.1 BTB_POZ_SKP1 4..126 CDD:349631 34/122 (28%)
Skp1 112..159 CDD:396171 17/44 (39%)
skr-15NP_494662.1 Skp1 20..127 CDD:214704 29/107 (27%)
SKP1 23..176 CDD:227528 46/153 (30%)
Skp1 101..167 CDD:279768 22/65 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160705
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.