DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpA and skr-2

DIOPT Version :9

Sequence 1:NP_001033818.1 Gene:SkpA / 31016 FlyBaseID:FBgn0025637 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_492512.1 Gene:skr-2 / 172773 WormBaseID:WBGene00004808 Length:174 Species:Caenorhabditis elegans


Alignment Length:162 Identity:92/162 - (56%)
Similarity:120/162 - (74%) Gaps:7/162 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKLQSSDEEIFDTDIQIAKCSGTIKTMLEDCGMEDDE--NA-IVPLPNVNSTILRKVLTWAHYHK 65
            ||:.|||:|||.....:.:.|.|:.|:|.|.|::|||  || .:|:.||.::||:||:.|...|:
 Worm    16 IKISSSDDEIFLVPRNVIRLSNTLNTLLVDLGLDDDEGTNAEPIPVQNVTASILKKVINWCTKHQ 80

  Fly    66 DDPQPTEDDESKEKRTD-DIISWDADFLKVDQGTLFELILAANYLDIKGLLELTCKTVANMIKGK 129
            .||.||||   .||:|| .|..||..||.:|||||||||||||||||||||::.|::||||||||
 Worm    81 SDPIPTED---SEKKTDGSIQDWDKKFLDIDQGTLFELILAANYLDIKGLLDVACQSVANMIKGK 142

  Fly   130 TPEEIRKTFNIKKDFSPAEEEQVRKENEWCEE 161
            :|:|||:.||||.||:..|.||:||||.||::
 Worm   143 SPDEIRRAFNIKDDFTAEEREQIRKENAWCDD 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpANP_001033818.1 BTB_POZ_SKP1 4..126 CDD:349631 68/125 (54%)
Skp1 112..159 CDD:396171 30/46 (65%)
skr-2NP_492512.1 SKP1 16..174 CDD:227528 92/160 (58%)
Skp1 16..124 CDD:214704 58/110 (53%)
Skp1 99..172 CDD:279768 51/72 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160707
Domainoid 1 1.000 56 1.000 Domainoid score I7318
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38775
Inparanoid 1 1.050 217 1.000 Inparanoid score I2312
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 1 1.000 - - mtm4845
orthoMCL 1 0.900 - - OOG6_100934
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X346
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.