powered by:
Protein Alignment SkpA and C42D4.18
DIOPT Version :9
Sequence 1: | NP_001033818.1 |
Gene: | SkpA / 31016 |
FlyBaseID: | FBgn0025637 |
Length: | 162 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001255289.1 |
Gene: | C42D4.18 / 13196550 |
WormBaseID: | WBGene00206380 |
Length: | 168 |
Species: | Caenorhabditis elegans |
Alignment Length: | 55 |
Identity: | 15/55 - (27%) |
Similarity: | 25/55 - (45%) |
Gaps: | 6/55 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 110 DIKGLLELTCKTVANMIKG--KTPEEIRKTFNIKKDFSPAEEEQVRKENEWCEEK 162
|:|.|.| :...|.|. .:|:|:.:...|::.......|.:||..|..:||
Worm 11 DLKALTE----SRKQMEKAGLLSPQELSRKICIEEQMKFEIAECLRKAQEKADEK 61
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5201 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.