DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpA and C42D4.18

DIOPT Version :9

Sequence 1:NP_001033818.1 Gene:SkpA / 31016 FlyBaseID:FBgn0025637 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_001255289.1 Gene:C42D4.18 / 13196550 WormBaseID:WBGene00206380 Length:168 Species:Caenorhabditis elegans


Alignment Length:55 Identity:15/55 - (27%)
Similarity:25/55 - (45%) Gaps:6/55 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 DIKGLLELTCKTVANMIKG--KTPEEIRKTFNIKKDFSPAEEEQVRKENEWCEEK 162
            |:|.|.|    :...|.|.  .:|:|:.:...|::.......|.:||..|..:||
 Worm    11 DLKALTE----SRKQMEKAGLLSPQELSRKICIEEQMKFEIAECLRKAQEKADEK 61

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpANP_001033818.1 BTB_POZ_SKP1 4..126 CDD:349631 4/15 (27%)
Skp1 112..159 CDD:396171 12/48 (25%)
C42D4.18NP_001255289.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.