DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmt4-20 and kmt5c

DIOPT Version :9

Sequence 1:NP_001245453.1 Gene:Hmt4-20 / 31015 FlyBaseID:FBgn0025639 Length:1300 Species:Drosophila melanogaster
Sequence 2:NP_001091656.1 Gene:kmt5c / 569041 ZFINID:ZDB-GENE-080523-2 Length:522 Species:Danio rerio


Alignment Length:369 Identity:155/369 - (42%)
Similarity:206/369 - (55%) Gaps:35/369 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 MSPRELSENDDLATSLILDPHLGFQTHKMNIRFRPLKVDTQQLKAIVDDFIHTQNYDIAIQRIYE 216
            ||.|||.|.|||||||:|||.|||.||||||...|.......|:..:..|..|.::......:.:
Zfish     7 MSVRELCETDDLATSLVLDPLLGFSTHKMNISTPPEIRRWGYLRETLLRFKRTHDFQATFDALLD 71

  Fly   217 GPWIPRHLKNKNKIATKRLHDHIVRYLRVFDKDSGFAIEACYRYTLEEQRGAKISSTKRWSKNDK 281
            |.|:..:.........:.|..|:.||:..|..:||..||.|.||: .|..||||:||:.|...::
Zfish    72 GEWVSDYFAGLGSHRQELLKQHMYRYMTAFLLESGVNIEPCNRYS-SETNGAKITSTRHWLVGER 135

  Fly   282 IECLVGCIAELTEAEEAALLHSGKNDFSVMYSCRKNCAQLWLGPAAYINHDCRANCKFLATGRDT 346
            :|.|.||||||: .|::|:|.:|.||||||||.||.||||||||||:||||||.||||:...::.
Zfish   136 VEVLQGCIAELS-PEDSAVLRAGVNDFSVMYSTRKRCAQLWLGPAAFINHDCRPNCKFVPGDKNG 199

  Fly   347 ACVKVLRDIEVGEEITCFYGEDFFGDSNRYCECETCERRGTGAFAGKDDGLMLGLSMGLGLASSG 411
            |||||:|.|..||||||:||:.|||:.|..|||.||||||.|:|..:|        .....|.:|
Zfish   200 ACVKVVRPISPGEEITCYYGDSFFGEKNEMCECCTCERRGEGSFKKRD--------QSPDFACTG 256

  Fly   412 PGNNGGYRLRETDNRINRIKSRANSTN----STSNSNSNTNDSTGPSETSSTNGLVASGGAGGAT 472
            ..:...|..||||.|:||  ||.|.|.    :.|||.....::.  |:.:..|.||.|       
Zfish   257 DPSGQKYEFRETDLRLNR--SRGNGTPKPFLAVSNSALPIRNTF--SQRTKRNALVLS------- 310

  Fly   473 GAAMLPTPSQQSTGGKEATAAVSLLEKKLPNVVVS--PLTMKEL 514
                    ..:.|..::.......:||::.|::.|  .|.:|||
Zfish   311 --------KMRKTDRRKREEQCKQVEKRMQNLLSSFPHLKLKEL 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hmt4-20NP_001245453.1 SET 256..372 CDD:214614 70/115 (61%)
kmt5cNP_001091656.1 SET 115..225 CDD:214614 68/111 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002279
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12977
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1322
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.130

Return to query results.
Submit another query.