DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmt4-20 and CG14434

DIOPT Version :9

Sequence 1:NP_001245453.1 Gene:Hmt4-20 / 31015 FlyBaseID:FBgn0025639 Length:1300 Species:Drosophila melanogaster
Sequence 2:NP_001284969.1 Gene:CG14434 / 31632 FlyBaseID:FBgn0029915 Length:214 Species:Drosophila melanogaster


Alignment Length:158 Identity:36/158 - (22%)
Similarity:55/158 - (34%) Gaps:40/158 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   838 YKKNLLASFDPDPPSTQGIKEQLKDESVTYSPVKQKRSRRAAALAAAQSIHCEALGGFPTGSTGS 902
            |:|:|:|      |.....:...|::||         :....::..|...:.|.....|.||.|.
  Fly     4 YRKHLVA------PIIGYRRYVAKNKSV---------NNMCESVTPADQRNVEVKARIPGGSEGF 53

  Fly   903 QRKRAQAGEPTTSCSSTTISNVE-----PL--------LKTPERRL------------KLTLRMK 942
            :::...|...:.|..:..|...:     ||        |:||.|..            ||:...|
  Fly    54 EQRLILARNLSGSQDAQLIEQRDVFFESPLGGRLKLRYLQTPSRSQLVYYDRPDVAGPKLSKFNK 118

  Fly   943 RSPILDEVIELGTSLSNGGAGRGAPGSH 970
            ......||:|...|.|||..|..|...|
  Fly   119 TEVDEPEVLEKILSQSNGVLGVLAKRRH 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hmt4-20NP_001245453.1 SET 256..372 CDD:214614
CG14434NP_001284969.1 CYTH-like_AC_IV-like 39..205 CDD:143628 27/108 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1437
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.