DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmt4-20 and set9

DIOPT Version :9

Sequence 1:NP_001245453.1 Gene:Hmt4-20 / 31015 FlyBaseID:FBgn0025639 Length:1300 Species:Drosophila melanogaster
Sequence 2:NP_588078.1 Gene:set9 / 2539545 PomBaseID:SPCC4B3.12 Length:441 Species:Schizosaccharomyces pombe


Alignment Length:301 Identity:86/301 - (28%)
Similarity:142/301 - (47%) Gaps:59/301 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 DDLATSLILDPHLGF-QTHKMNIRFRPL------KVDTQQLKAIVDDFIHTQ-NYDIAIQRIYE- 216
            ||:.|.|::|....: |.||:    |.|      ::::..:..|:..:|..| :.|.|.:.|.: 
pombe    15 DDVCTCLLVDKVFYWSQIHKV----RKLVDRSIERMESCSIINIITKYIIEQTDLDQAAKNILQF 75

  Fly   217 ---GPWIPRHLKNKNKIATKRLHDHIVRYLRVFDKDSGFAIEACYRYTLEEQRGAKISSTKRWSK 278
               .|.: |.|.:.:.:|..|   |:..||.::.....|.|.:..:|....:..|.:.:.:..:.
pombe    76 RELDPLL-RRLSSTSLLAFTR---HLKYYLSLYLPSCKFEICSTNQYFSSSKPEACVIARESINA 136

  Fly   279 NDKIECLVGCIAELTEAEEAALLHSGKNDFSVMYSCRKNCAQLWLGPAAYINHDCRANCKFLATG 343
            .:.|..|.|.|.:|:..||.. :..|| |||:::|.|.:...|:||||.::||||.|||:|..:|
pombe   137 GEDITDLCGTIIKLSPKEERN-IGIGK-DFSILHSSRLDSMCLFLGPARFVNHDCNANCRFNTSG 199

  Fly   344 RDTACVKVLRDIEVGEEITCFYGEDFFGDSNRYCECETCERRGTGAFAGKDDGLMLGLSMGLGLA 408
            : ...::.:|||:.|||||.||..::||..|..|.|.:|||.|.                     
pombe   200 K-RIWLRCVRDIKPGEEITTFYSSNYFGLENCECLCVSCERMGI--------------------- 242

  Fly   409 SSGPGNNGGYRLRETDNRINRIKSRANSTNSTSNSNSNTND 449
                  ||..:|..|.         |.||:.:|.|:|:.:|
pombe   243 ------NGFKKLFHTS---------ATSTSCSSKSSSDVSD 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hmt4-20NP_001245453.1 SET 256..372 CDD:214614 41/115 (36%)
set9NP_588078.1 SET 1..430 CDD:225491 86/301 (29%)
SET 127..220 CDD:279228 36/95 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 55 1.000 Domainoid score I3198
eggNOG 1 0.900 - - E1_COG1437
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002279
OrthoInspector 1 1.000 - - oto100813
orthoMCL 1 0.900 - - OOG6_104297
Panther 1 1.100 - - LDO PTHR12977
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1322
SonicParanoid 1 1.000 - - X2124
TreeFam 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.