DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmt4-20 and Kmt5c

DIOPT Version :9

Sequence 1:NP_001245453.1 Gene:Hmt4-20 / 31015 FlyBaseID:FBgn0025639 Length:1300 Species:Drosophila melanogaster
Sequence 2:XP_006539832.1 Gene:Kmt5c / 232811 MGIID:2385262 Length:504 Species:Mus musculus


Alignment Length:318 Identity:96/318 - (30%)
Similarity:148/318 - (46%) Gaps:57/318 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 MSPRELSENDDLATSLILDPHLGFQTHKMNIRFRPLKVDTQQLKAIVDDFIHTQNYDIAIQRIYE 216
            ::.|||.|||||||||:|||:|||:|||||:...|.......|::.::.|:..::.:.|.:.:..
Mouse     6 VTARELCENDDLATSLVLDPYLGFRTHKMNVSPVPTLRRQHHLRSALEAFLRQRDLEAAFRALTL 70

  Fly   217 GPWIPRHLKNKNKIATKRLHDHIVRYLRVFDKDSGFAIEACYRYTLEEQRGAKI----------S 271
            |.|:..:.:::.......|..| :|..|..| |.|..:..  :..|.:::.|.:          .
Mouse    71 GGWMAHYFQSRAPRQEAALKTH-MRTPRPRD-DPGHTVSD--KVDLVQEKEAPVVGPAHLPALPH 131

  Fly   272 STKRWSKNDKIECL----VGCIAELTEAEEAA------LLHSGKNDFSVMYSCRKNCA---QLWL 323
            |:.|:|......||    ..|.|..|......      :|......:|..::..::|.   :..|
Mouse   132 SSLRFSATSAPSCLRVASPFCPAPATPWRPMGPRLCLPVLGRRMRSWSCWWAALQSCVKRMKTCL 196

  Fly   324 GPAAYINHDCR---------------ANCKFLATGRDTACVKVLRDIEVGEEITCFYGEDFFGDS 373
            ||....:..|.               ::..|:.:..:|||||||||||.|:|:||||||.|||:.
Mouse   197 GPVRTTSASCTPPEKGVPSCGLAQLPSSTMFVPSDGNTACVKVLRDIEPGDEVTCFYGEGFFGEK 261

  Fly   374 NRYCECETCERRGTGAF--AGKDDGLMLGLSMGLGLASSGPGNNGGYRLRETDNRINR 429
            |.:|||.||||:|.|||  ..::..|.             |.....|.||||..|:.:
Mouse   262 NEHCECYTCERKGEGAFRLQPREPELR-------------PKPLDKYELRETKRRLQQ 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hmt4-20NP_001245453.1 SET 256..372 CDD:214614 39/153 (25%)
Kmt5cXP_006539832.1 SET <196..279 CDD:394802 38/82 (46%)
PHA02682 281..>346 CDD:177464 8/39 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1437
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5024
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002279
OrthoInspector 1 1.000 - - otm42833
orthoMCL 1 0.900 - - OOG6_104297
Panther 1 1.100 - - O PTHR12977
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2124
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.720

Return to query results.
Submit another query.