DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Roc1a and HRT1

DIOPT Version :9

Sequence 1:NP_001138143.2 Gene:Roc1a / 31014 FlyBaseID:FBgn0025638 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_014508.1 Gene:HRT1 / 853986 SGDID:S000005493 Length:121 Species:Saccharomyces cerevisiae


Alignment Length:141 Identity:66/141 - (46%)
Similarity:79/141 - (56%) Gaps:34/141 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEVDED-GYEVPSSSSKG-----DKKRFEVKKVSGQQKSRVIVNECTDGNTSSFPLRRKQWNAVA 59
            |:|||| ...:..||::.     .|||||:||                            |.|||
Yeast     8 MDVDEDESQNIAQSSNQSAPVETKKKRFEIKK----------------------------WTAVA 44

  Fly    60 LWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPL 124
            .|:|||.||||||||||||:.|||||....:.|..||..||||||||||.|||::|:|||..|||
Yeast    45 FWSWDIAVDNCAICRNHIMEPCIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIKTRDACPL 109

  Fly   125 DNREWDFQKYG 135
            ||:.|...:.|
Yeast   110 DNQPWQLARCG 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Roc1aNP_001138143.2 APC11 53..136 CDD:227521 52/83 (63%)
zf-rbx1 53..126 CDD:289448 48/72 (67%)
HRT1NP_014508.1 APC11 33..121 CDD:227521 58/116 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 106 1.000 Domainoid score I1444
eggNOG 1 0.900 - - E1_COG5194
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 154 1.000 Inparanoid score I1095
Isobase 1 0.950 - 0 Normalized mean entropy S381
OMA 1 1.010 - - QHG54028
OrthoFinder 1 1.000 - - FOG0003438
OrthoInspector 1 1.000 - - otm46583
orthoMCL 1 0.900 - - OOG6_102466
Panther 1 1.100 - - LDO PTHR11210
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1071
SonicParanoid 1 1.000 - - X2333
TreeFam 1 0.960 - -
1413.810

Return to query results.
Submit another query.