DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Roc1a and RBX1

DIOPT Version :9

Sequence 1:NP_001138143.2 Gene:Roc1a / 31014 FlyBaseID:FBgn0025638 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_001154725.1 Gene:RBX1 / 832179 AraportID:AT5G20570 Length:142 Species:Arabidopsis thaliana


Alignment Length:156 Identity:90/156 - (57%)
Similarity:94/156 - (60%) Gaps:52/156 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EDGYEVPSSSSKGDKKRFEVKKVSGQQKSRVIVNECTDGNTSSFPLRRKQWNAVALWAWDIVVDN 69
            |....|.:|||....||||:||                            |:|||||||||||||
plant    15 EASSSVAASSSNKKAKRFEIKK----------------------------WSAVALWAWDIVVDN 51

  Fly    70 CAICRNHIMDLCIECQANQASATSEECTVAW------------------------GVCNHAFHFH 110
            |||||||||||||||||||||||||||||||                        ||||||||||
plant    52 CAICRNHIMDLCIECQANQASATSEECTVAWEDDQNNCNKYFCILDCSMKDDHLEGVCNHAFHFH 116

  Fly   111 CISRWLKTRQVCPLDNREWDFQKYGH 136
            ||||||||||||||||.||:||||||
plant   117 CISRWLKTRQVCPLDNSEWEFQKYGH 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Roc1aNP_001138143.2 APC11 53..136 CDD:227521 77/106 (73%)
zf-rbx1 53..126 CDD:289448 69/96 (72%)
RBX1NP_001154725.1 RING 30..142 CDD:302633 83/139 (60%)
zf-rbx1 31..132 CDD:289448 74/128 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 138 1.000 Domainoid score I1578
eggNOG 1 0.900 - - E1_COG5194
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6872
Inparanoid 1 1.050 204 1.000 Inparanoid score I1290
OMA 1 1.010 - - QHG54028
OrthoDB 1 1.010 - - D1587140at2759
OrthoFinder 1 1.000 - - FOG0003438
OrthoInspector 1 1.000 - - oto3149
orthoMCL 1 0.900 - - OOG6_102466
Panther 1 1.100 - - LDO PTHR11210
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2333
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.